(data stored in ACNUC7421 zone)

EMBL: CP001630.PE298

CP001630.PE298       Location/Qualifiers
FT   CDS_pept        complement(330650..331321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0303"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein); SMART:
FT                   nuclease (SNase domain protein); KEGG: mno:Mnod_4939
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34272"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF6"
FT                   /inference="protein motif:PFAM:PF00565"
FT                   /protein_id="ACU34272.1"
FT                   /translation="MESTALVRRTPLRLLLLVPALLLTACAAQPLAAPAVPAPAAEDAA
FT                   PDAAERWDRSGAWSTPSPAQPDPADLAPARASGVVDARTIAVAGGGSVRLLGLAEPGAC
FT                   WSRAAADFLGSLVAQKDLALDGASVRLPGGTDLSAQLVSQGMARAEPDAASTLTRAEAA
FT                   ARKAGLGLWGAPCGGSDSVVTTPAPTTRALARCTANTSTTPAGLPGSPVLDHDTDGVAC
FT                   A"
     atggagagca ccgcgctggt ccgcaggacg ccgctccggc tactgctgct ggtccccgcc        60
     ctgctgctga cggcctgcgc cgcgcagccg ctcgccgctc ccgcagtgcc cgcgccggcc       120
     gccgaggacg ccgccccgga cgccgccgag cggtgggacc ggtccggggc gtggtcgacc       180
     ccctcccccg cgcagcccga ccccgccgac ctcgcgcccg cccgcgcctc gggggtcgtc       240
     gacgcccgca cgatcgccgt ggcgggcggc ggctcggtcc ggctgctggg gctggccgag       300
     cccggcgcct gctggtcgcg cgcggcggcc gacttcctcg gctcgctggt ggcgcagaag       360
     gacttggcgc tcgacggcgc gtccgtgcgc ctgcccggcg ggaccgacct gtccgcccag       420
     ctcgtcagcc agggcatggc tcgcgccgaa ccggacgcgg ccagcaccct gacccgcgcc       480
     gaggccgccg ccaggaaggc gggcctcggc ctgtggggcg cgccgtgcgg cggctccgac       540
     tcggtggtga cgacgcccgc gccgaccacg cgcgccctgg cgcggtgcac cgcgaacacc       600
     tccacgaccc ccgccggcct gcccggctca ccagttctcg accacgacac ggatggggtg       660
     gcctgcgcat ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page