(data stored in ACNUC7421 zone)

EMBL: CP001630.PE299

CP001630.PE299       Location/Qualifiers
FT   CDS_pept        complement(331443..331889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0304"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pzu:PHZ_c1913 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34273"
FT                   /db_xref="InterPro:IPR027961"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34273.1"
FT                   /translation="MDPSLVADAMRKSVPWVQTNGVEFTEVGVDRVVAALPDRPESRNH
FT                   VGGPHAAMLFGVGETASGAVVMAAFGGHLDRATPLVARAEIAYRKLALGPLTAEAVLER
FT                   PAADVVAELEGGQRPEFPVRVSVRDAEGVVTTELVVTWTLKPQR"
     atggatccct cgctcgtcgc ggacgcgatg cggaagtcag tgccgtgggt gcagaccaac        60
     ggcgtggagt tcaccgaggt cggcgtggac cgcgtggtcg cggcccttcc cgaccggccg       120
     gagtcccgga accacgtggg cgggccccac gcggccatgc tgttcggggt cggcgagacc       180
     gcctccggcg ccgtggtgat ggcggcgttc ggcggccacc tggaccgggc gacgccgctc       240
     gtggcgcgcg cggagatcgc ctaccgcaag ctcgcgctcg gcccgctcac ggcggaggcg       300
     gtgctggagc ggcccgccgc cgacgtggtc gccgagctgg agggcgggca gcggccggag       360
     ttcccggtgc gggtgtcggt gcgcgacgcc gaaggcgtgg tcaccaccga actggtggtg       420
     acgtggaccc tcaagccgca acgatga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page