(data stored in ACNUC7421 zone)

EMBL: CP001630.PE3

CP001630.PE3         Location/Qualifiers
FT   CDS_pept        3806..4720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0003"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   NAD-binding; 6-phosphogluconate dehydrogenase domain
FT                   protein; NADP oxidoreductase coenzyme F420-dependent; KEGG:
FT                   dde:Dde_3470 6-phosphogluconate dehydrogenase- like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33977"
FT                   /db_xref="GOA:C6WCF6"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCF6"
FT                   /inference="protein motif:TFAM:TIGR00872"
FT                   /protein_id="ACU33977.1"
FT                   /translation="MQLGIVGLGKMGFNMRERVRRAGHEVVGYDRNPDVSDTTSLADLA
FT                   AKLTGPRVVWVMVPAGEITRNTVAELSEVLSEGDLVIDGGNSRFTDDALNAAKLAEKGI
FT                   GYLDCGVSGGVWGLENGYGLMVGGDAADVERAMPIFDALRPEGPREEGFAHAGKLGAGH
FT                   FAKMVHNGIEYGLMQAYAEGFELLEASELVENVPATIKAWQRGTVVRSWLLDLLVNALD
FT                   SDPELDDLRGYVEDSGEGRWTVEEAINHAVPAPVISAALFARFASRQSDSPAMRAVAAL
FT                   RNQFGGHAVQSAGPSSGSGSTQG"
     gtgcagctcg gaatcgtcgg cctcggcaaa atgggcttca acatgcgcga gcgggtccgc        60
     cgcgctggtc acgaggtcgt cggctacgac cgcaacccgg acgtcagcga caccacgtcg       120
     ctcgccgacc tcgcggccaa gctgaccggc cccagggtgg tctgggtgat ggtccccgcc       180
     ggggagatca ccaggaacac cgtcgccgag ctgagcgagg tgctcagcga gggcgacctc       240
     gtcatcgacg gcggcaactc gcggttcacc gacgacgccc tcaacgccgc caagctggcc       300
     gagaagggca tcggctacct cgactgcggc gtgtccggcg gcgtctgggg cctggagaac       360
     ggctacggcc tgatggtcgg cggcgacgcg gccgacgtcg agcgcgccat gccgatcttc       420
     gacgcgctgc gccccgaggg gccgcgcgag gagggcttcg cgcacgcggg caagctcggc       480
     gcgggccact tcgccaagat ggtgcacaac ggcatcgagt acggcctgat gcaggcgtac       540
     gccgagggct tcgagctcct ggaggcctcg gagctggtcg agaacgtgcc cgccaccatc       600
     aaggcgtggc agcgcggcac cgtcgtccgc tcctggctgc tcgacctgct ggtcaacgcc       660
     ctggactcgg acccggagct ggacgacctg cgcggctacg tcgaggactc cggcgagggc       720
     cggtggaccg tcgaggaggc gatcaaccac gcggtgcccg cgccggtgat ctccgccgcg       780
     ctgttcgccc gcttcgcgtc gcgccagtcc gactcgcccg ccatgcgcgc ggtggcggcg       840
     ctgcggaacc agttcggcgg gcacgccgtg cagtccgcgg gcccgtcctc cggctccggc       900
     agcacgcagg gctga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page