(data stored in ACNUC7421 zone)

EMBL: CP001630.PE30

CP001630.PE30        Location/Qualifiers
FT   CDS_pept        complement(33316..34593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0030"
FT                   /product="FAD-linked oxidoreductase"
FT                   /EC_number="1.1.3.8"
FT                   /note="KEGG: bur:Bcep18194_B3008 FAD-linked oxidoreductase;
FT                   TIGRFAM: FAD-linked oxidoreductase; PFAM:
FT                   D-arabinono-14-lactone oxidase; FAD linked oxidase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34004"
FT                   /db_xref="GOA:C6WCI3"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI3"
FT                   /inference="protein motif:TFAM:TIGR01679"
FT                   /protein_id="ACU34004.1"
FT                   /translation="MAPPWTNWARTETAAPIRVEHPTTAEGISEVVRTADAVRARGSGH
FT                   SFTGVAVAPSVALDLDRWTGLVDVAGELVTVRAGTTLRQLNELLHREGLAMPNLGDIDA
FT                   QTIAGATATGTHGTGAALGGLATTIVALEVVLADGSLVRCSPTERPDLFEAARLGLGAV
FT                   GVISTLTLRCVPSFVLHAREYPARLDAVLEEFDHLTATEDHVEFHWFPHGDRVIVKRNN
FT                   RVDEPRAPLSGLRRFYEYDVMENAAFGAVCKVARAVPATARGLNRMCGALIGERDYRDQ
FT                   SHRVFTTPRRVRFVETEYAVPRAELHGVLRELRAAVAGLEHGVIVPVEVRVARGDDIWL
FT                   STAHGRDTAYVAVHQYVGMPHRRYFDAFERIALAVGGRPHWGKLHSLGAEELATRYPRF
FT                   ADFRRVRAEVDPDRKFGNRHLERVLG"
     atggcacccc cctggacgaa ctgggcgcgg accgagaccg cagccccgat ccgggtcgag        60
     caccccacga cggcggaggg gatctccgaa gtcgtccgca ccgccgacgc cgtccgcgcg       120
     cggggcagcg gccactcctt caccggggtc gccgtcgccc cctccgtcgc gctcgacctc       180
     gaccgctgga ccggcctggt cgacgtggcg ggagagctgg tgaccgtccg cgcgggcacc       240
     acgctccggc agctcaacga gctgctgcac cgggaggggc tcgcgatgcc caacctcggc       300
     gacatcgacg cccagaccat cgcgggcgcc accgccaccg gcacccacgg caccggcgcg       360
     gcgctcggcg gcctggccac cacgatcgtc gcgctggagg tcgtgctcgc cgacggctcg       420
     ctcgtccgct gctcccccac cgagcgcccc gacctgttcg aggcggccag gctcggcctc       480
     ggcgcggtcg gcgtgatcag cacgctgacc ctgcgctgcg tgccgtcgtt cgtgctgcac       540
     gcccgcgagt acccggccag gctcgacgcg gtgctggagg agttcgacca cctcaccgcg       600
     accgaggacc acgtggagtt ccactggttc ccgcacggcg accgggtgat cgtcaagcgg       660
     aacaaccggg tggacgagcc gcgcgcgccg ctgtccgggc tgcgccggtt ctacgagtac       720
     gacgtgatgg agaacgccgc gttcggcgcg gtgtgcaagg tcgcccgcgc cgtgcccgcc       780
     acggccaggg ggctcaaccg gatgtgcggg gcgctgatcg gcgagcgcga ctaccgcgac       840
     cagtcgcacc gcgtcttcac caccccgcgc cgggtgcggt tcgtggagac cgagtacgcg       900
     gtgccccgcg ccgagctgca cggggtgctg cgcgagctgc gcgccgccgt ggccgggctg       960
     gagcacgggg tgatcgtgcc ggtggaggtg cgggtcgcgc ggggcgacga catctggctg      1020
     tccaccgcgc acgggcggga caccgcctac gtcgcggtgc accagtacgt ggggatgccg      1080
     caccggcggt acttcgacgc gttcgagcgg atcgcgctgg cggtgggcgg caggccgcac      1140
     tggggcaagc tgcactcgct gggcgccgag gagctggcga cccgctaccc ccggttcgcg      1200
     gacttccgcc gcgtgcgcgc cgaggtcgac ccggaccgga agttcgggaa ccggcacctg      1260
     gagcgggtgc tgggctga                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page