(data stored in ACNUC7421 zone)

EMBL: CP001630.PE300

CP001630.PE300       Location/Qualifiers
FT   CDS_pept        332019..332537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0305"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: atc:AGR_C_1531 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34274"
FT                   /db_xref="GOA:C6WGF8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF8"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU34274.1"
FT                   /translation="MTTPEDAHGGGRSDEALADRFGTALVRLNKMHAALSASLSKAGID
FT                   KASFVLLANLAQMGPSRASALAEAVFSDPSTVSRQVAGLVKDGLVERRADPDDGRASVL
FT                   AVTDNGLSLLHERRRVRNAALARLFSDWSTHDWTTFVEHFERFVEGYEKALPDFIAEGG
FT                   QGPRSEGEK"
     atgacgacgc ccgaggacgc ccacgggggc gggcggtccg acgaggcgct cgccgaccgc        60
     ttcggcacgg cactcgttcg gctgaacaag atgcacgccg cgctctccgc cagcctcagc       120
     aaggcgggca tcgacaaggc ctccttcgtc ctcctcgcca acctggcgca gatgggcccg       180
     tcccgcgcga gcgcgctggc ggaggcggtc ttctcggacc cgtccacggt cagccgccag       240
     gtcgccgggc tggtcaagga cgggctggtg gagcgcaggg cggaccccga cgacggccgg       300
     gcgagcgtgc tcgccgtgac cgacaatggg ttgtccctcc tgcacgagcg gcgacgggtg       360
     cgcaacgcgg cgctggcccg cctcttctcg gactggtcca cccacgactg gaccacgttc       420
     gtcgagcact tcgagcgctt cgtcgaggga tacgagaaag cgctcccgga tttcatcgca       480
     gagggcggac aggggccgcg ctccgaaggg gagaagtga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page