(data stored in ACNUC7421 zone)

EMBL: CP001630.PE301

CP001630.PE301       Location/Qualifiers
FT   CDS_pept        332537..334204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0306"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ppg:PputGB1_3285 EmrB/QacA family drug resistance
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34275"
FT                   /db_xref="GOA:C6WGF9"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF9"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACU34275.1"
FT                   /translation="MSETTTQAGATPPGAALLTHRQILTILSGLLMGMFLAALDQMIVA
FT                   TAMKTIADHLNGQTIQAWATTAYLITSTITTPLYGKLSDIYGRKPMYLTAISMFLVGSL
FT                   LCGIANSMYELAAFRAVQGLGAGGLMSLAFAILADITSPRERSRYAGYFMAVFGVASVA
FT                   GPVVGGLFAGMDHFLGFAGWRWVFLVNVPIALAALAVVAKVLNIPHQRVDHRVDFLGAI
FT                   TLTVGLVPLLIVAEQGREWGWGSATAIAMYVVGVLGLVAFVWAEKRAGDEALLPLRLFR
FT                   KQTFALGNTINFVLGAGMFGGMVSIPLYLQIVQGHSATTAGLMMLPMTLGIMTAAGTSG
FT                   KITSKTGRYKVFPVVGFAVMTASLFLFSTVGVDTATWQPMALMFTMGLGLGLCMQTLLI
FT                   AIQNDAEPRDMGVATSSATFFRQIGGTVGAAVFLSVLFSTVGDKIGEALRSAMGTDAFR
FT                   AALARPENQAFAQQLQSGGASADLNNTEFLSKLDPVLARPFLEGFSSAIDTVFFVGALV
FT                   TLVGFAIVWFLREVPLSDRSGLERSKDEADAASTIALH"
     atgtcggaga cgacaaccca ggcgggagcg acgccacccg gcgccgcact gctgacccac        60
     cggcagatcc tgacgatcct gtccgggctg ctcatgggca tgttcctggc cgcgctcgac       120
     cagatgatcg tcgcgacggc catgaagacc atcgcggacc acctgaacgg gcagaccatc       180
     caggcctggg cgaccaccgc ctacctgatc acgtcgacga tcacgacgcc gctgtacggc       240
     aagctgtcgg acatctacgg ccgcaagccg atgtacctca ccgcgatctc gatgttcctg       300
     gtcggctcgc tgctgtgcgg catcgccaac tcgatgtacg agctggccgc gttccgcgcg       360
     gtccagggcc tcggcgcggg cggcctcatg tcgctggcgt tcgcgatcct ggccgacatc       420
     acctcgccgc gcgagcgcag ccggtacgcg ggctacttca tggccgtctt cggcgtcgcc       480
     agcgtcgcgg gcccggtcgt cggcggcctg ttcgcgggca tggaccactt cctcggcttc       540
     gcgggctggc gctgggtgtt cctggtgaac gtcccgatcg cgctcgccgc gctggccgtc       600
     gtcgccaagg tcctcaacat cccgcaccag cgggtcgacc accgcgtcga cttcctcggc       660
     gcgatcacgc tgaccgtcgg cctggtgccg ctgctgatcg tggccgagca gggccgcgag       720
     tggggctggg gctcggccac cgcgatcgcc atgtacgtcg tcggcgtgct cggcctggtg       780
     gcgttcgtgt gggcggagaa gcgcgcgggc gacgaggcgc tgctgccgct gaggctgttc       840
     cgcaagcaga ccttcgcgct cggcaacacg atcaacttcg tgctcggcgc gggcatgttc       900
     ggcggcatgg tctccatccc gctgtacctg cagatcgtgc agggccactc ggccaccacg       960
     gcgggcctga tgatgctgcc gatgaccctc ggcatcatga ccgcggcggg caccagcggc      1020
     aagatcacct cgaagaccgg ccgctacaag gtgttcccgg tcgtcggctt cgcggtcatg      1080
     accgcgtcgc tgttcctgtt cagcacggtc ggcgtggaca ccgcgacctg gcagccgatg      1140
     gcgctgatgt tcaccatggg cctcggcctg ggcctgtgca tgcagaccct gctcatcgcg      1200
     atccagaacg acgccgagcc ccgcgacatg ggcgtggcga cctcgtcggc cacgttcttc      1260
     cggcagatcg gcggcacggt cggcgccgcg gtgttcctgt ccgtcctgtt cagcacggtc      1320
     ggcgacaaga tcggcgaggc gctgcgctcg gccatgggca ccgacgcgtt ccgcgccgcg      1380
     ctcgcccgac ccgagaacca ggcgttcgcg cagcagctcc agagcggcgg cgcgtcggcg      1440
     gacctgaaca acaccgagtt tctgtccaag ctggacccgg tgctggccag gccgttcctg      1500
     gagggcttct cctcggcgat cgacacggtg ttcttcgtgg gcgccctcgt gaccctggtc      1560
     gggttcgcga tcgtgtggtt cctgcgcgag gtgccgctgt cggaccgctc gggcctggag      1620
     cgctcgaagg acgaggccga cgccgcgtcg accatcgccc tgcactga                   1668
//

If you have problems or comments...

PBIL Back to PBIL home page