(data stored in ACNUC7421 zone)

EMBL: CP001630.PE302

CP001630.PE302       Location/Qualifiers
FT   CDS_pept        complement(334313..334816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0307"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: Inorganic pyrophosphatase; KEGG: gdi:GDI3491
FT                   inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34276"
FT                   /db_xref="GOA:C6WGG0"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG0"
FT                   /inference="protein motif:PRIAM:3.6.1.1"
FT                   /protein_id="ACU34276.1"
FT                   /translation="MEFDVTIEIPKGVRNKYEMDHKTGRIRLDRTLFTATQYPADYGFV
FT                   DDTLGEDGDPLDALVLVQEPTFPGCLIRCRAIGMFRMTDEKGGDDKLLCVPSDDPRSEH
FT                   LRDIHHLSEFYRLEIQHFFEVYKDLEPGKSVEGATWVGRTEAEAEIVRSYQRLKDAVAR
FT                   GEEH"
     gtggagttcg acgtcaccat cgagatcccc aagggggtcc gcaacaagta cgagatggac        60
     cacaagacgg ggcgcatcag gctcgaccgc accctgttca cggccactca gtacccggcg       120
     gactacgggt tcgtcgatga caccctgggc gaggacggtg acccgctcga cgcgctcgtt       180
     ctcgtgcagg agccgacctt ccccggctgc ctgatccgct gccgcgcgat cggcatgttc       240
     cggatgaccg acgagaaggg cggcgacgac aagctgctct gcgtcccgtc ggacgacccg       300
     cgctcggagc acctgcggga catccaccac ctgagcgagt tctaccggct ggagatccag       360
     cacttcttcg aggtctacaa ggacctggag ccgggcaaga gcgtcgaggg cgcgacctgg       420
     gtcggccgca ccgaggcgga ggccgagatc gtgcgctcct accagcgcct caaggacgcc       480
     gtggcgcgcg gcgaggagca ctga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page