(data stored in ACNUC7421 zone)

EMBL: CP001630.PE303

CP001630.PE303       Location/Qualifiers
FT   CDS_pept        334943..337993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0308"
FT                   /product="D-alanyl-D-alaninecarboxypeptidase/D-alanyl-D-al
FT                   anine-endopeptidase"
FT                   /note="TIGRFAM: D-alanyl-D-alanine carboxypeptidase/D-
FT                   alanyl-D-alanine-endopeptidase; PFAM: peptidase S13
FT                   D-Ala-D-Ala carboxypeptidase C; KEGG: bpm:BURPS1710b_1102
FT                   putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34277"
FT                   /db_xref="GOA:C6WGG1"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG1"
FT                   /inference="protein motif:TFAM:TIGR00666"
FT                   /protein_id="ACU34277.1"
FT                   /translation="MPEEPSWPTVDGDDTDREQVRSPRPADPPTMRIALPKKSGGAEKT
FT                   ELIKIDRLRPPGGPTPRTDLPEAGGESGADAAAAAQQPSGAQRGTAAEQGATPAGPDGD
FT                   EITRPAGASQAETARPGDEDNRSGGQAGAGGAGAGGAGAAALAAGAAALAAGAAGAQAS
FT                   GAQGGGAQSGGGQAGGGPAGGGKSGPQQSNAPQSGGGQQSGGQQTGDGQQTGGAPSGST
FT                   PPGGVPAPGMASGAPAGGFPAPGTPAGGFPAPGTPAGGFPAPGGLLGGEPTRFDPPKSA
FT                   PLPEAGWPGTRAEVPSFDPARADAQLAAQRAAANRAQNSGRPESGQQQAPGQQGPGQQA
FT                   GGQQAPGQQGAGQQSPGQQGAGQQGPHQQGIGQQGPGQQGPGHLGAGQQGPGNQAGGQQ
FT                   GPGRQGQGGHGSGPHGTIPPGAIPPGSGQAGAGTGGFGQQGPGRQGPGSQGIRHQGGQS
FT                   ASEQTQKVSVTPGQFTFPPPGQQPGGEQHRAAPPGTIPPGANQSGTIPPGANQSGTIPP
FT                   GANQPGVADHPGSSADRRDDDAAFAAFAADSDERADVPAQRSKRKRPLVVVGALAAVLV
FT                   LFGGAALAAVQLGWLETGPTSTTQPPAPPAQVDLAVRALGPDAPAPTPAGVQAVLQGPL
FT                   ANGALGNLTGTVIDPASKTVLWHQGETTPLVPASTVKNLVAAAALLQLDHTTQFTTKVV
FT                   QGAEPGTVVLVGGGDPTLSSLPEGRSSVYPGAPTLDELVEQVKASGPITEVEYDISRYS
FT                   AEPGLAPGVDPNDVAAGFITNIGPLMLDGARSDPTKGDTPRTATPAPDAAKALADRLGA
FT                   TVGGKTLAPQAAKVLGEVKSVPLDQLIENMMQLSDNVLAETLAREVAKARNAETSYEGA
FT                   TKAVRDVLTENGFDLTGVITSDASGMSVQNKVPAKLLGDLLTAAARPDAATDPVTTRLR
FT                   PLLTALAVAGGNGTLKERFAQSPAGKGWIRGKTGTLTEVHSLAGVVVDTDGRLLVFAFM
FT                   SNGSGDALGARAGLDALAAQLRGCGCS"
     gtgcccgagg agccatcgtg gccgaccgtc gacggcgacg acacggaccg cgagcaggtc        60
     aggagcccgc gcccggctga tccgccgacg atgcgcatcg cgctgccgaa gaagtcgggc       120
     ggcgccgaga agaccgagct gatcaagatc gaccggttga ggccgcccgg cgggccgaca       180
     ccgaggaccg acctccccga ggccggtggc gagtcggggg cggacgccgc agccgcagct       240
     cagcagccct ccggggcgca gcgcgggacg gcggcggagc agggcgcgac accggcggga       300
     ccggacggcg acgagatcac gcggcccgcg ggcgcgagcc aggcggaaac cgcccgaccg       360
     ggtgacgagg acaaccggtc cggtgggcag gccggggctg gtggtgcggg cgccggtggt       420
     gcgggcgctg cggcgctggc cgccggtgcc gccgcgctgg cggcgggggc cgccggtgcg       480
     caggcaagtg gtgcgcaggg gggtggtgcg cagtccggtg gcggacaggc aggcggtggt       540
     cctgcgggcg gcgggaagtc cggcccccag cagtcgaacg cgccgcagtc cggtggcgga       600
     cagcagagtg gcggacagca gaccggtgac ggacagcaga ccggtggcgc gccttcgggc       660
     agcaccccgc ccggtggcgt ccccgcaccg ggtatggcct ccggcgctcc ggctggtggt       720
     ttcccggctc ctggcactcc tgccggcggg tttcccgctc ccggcactcc ggcgggtggg       780
     tttcccgctc ccggcggcct cctcggtggc gagccgacgc ggttcgaccc gcccaagtcc       840
     gccccgctgc ccgaggccgg gtggccgggg acgcgggccg aggtgccctc gttcgacccc       900
     gcgcgcgccg acgcccagct cgccgcgcag cgcgccgccg ccaaccgcgc ccagaactcg       960
     ggccgaccgg agagcggcca gcagcaagca cccggccagc agggacctgg tcagcaagca      1020
     ggcggccagc aagcacccgg tcagcaaggg gccggtcagc aaagtcctgg ccagcaggga      1080
     gccggtcagc aaggccctca ccagcaggga atcggccagc agggacctgg tcagcaagga      1140
     cccggtcacc taggggctgg ccagcagggg cccggtaacc aagcgggcgg ccagcagggg      1200
     cccggcaggc aggggcaggg cggccacggg agtggtccgc acggcaccat cccgcccggc      1260
     gccatccctc ccggctccgg gcaggccggt gcgggaacgg gtgggttcgg gcagcaggga      1320
     ccgggcaggc aggggccggg gagccagggc atccggcacc agggtggtca gagcgcgtcc      1380
     gagcagaccc agaaggtcag cgtcaccccc ggccagttca ccttcccgcc gcccggccag      1440
     cagcccggcg gtgagcagca ccgcgccgcg ccgcccggca ccatcccgcc cggcgccaac      1500
     cagtccggca ccatcccgcc cggcgccaac cagtccggca ccatcccacc cggcgccaac      1560
     cagcccggcg tcgccgacca ccccggctcc tccgccgacc ggcgggacga cgacgcggcc      1620
     ttcgccgcct tcgccgccga ctccgacgag cgggccgacg tgcccgccca gcggtccaag      1680
     cgcaagcggc ccctggtggt cgtcggcgcg ctcgccgccg tgctcgtcct gttcggcggc      1740
     gcggcgctgg ccgccgtgca gctcggctgg ctggagaccg ggcccacctc caccacccag      1800
     ccgcccgcgc caccggccca ggtcgacctc gcggtgcgcg ccctcggccc cgacgccccc      1860
     gcgcccaccc cggcgggcgt gcaggccgtg ctgcaggggc cgctcgccaa cggcgccctc      1920
     ggcaacctca ccggcaccgt catcgacccc gccagcaaga ccgtgctctg gcaccagggc      1980
     gagaccaccc cgctcgtgcc cgcgtccacg gtgaagaacc tggtcgccgc agccgcgctg      2040
     ctccagctcg accacaccac ccagttcacc accaaggtcg tgcagggcgc cgagcccggc      2100
     accgtggtcc tggtcggcgg cggcgacccg acgctgtcct cgctgcccga gggccgctcg      2160
     tcggtctacc ccggcgcgcc caccctggac gagctggtcg agcaggtgaa ggcctccggg      2220
     ccgatcaccg aggtcgagta cgacatcagc cgctacagcg ccgagcccgg cctcgccccc      2280
     ggcgtcgacc cgaacgacgt cgcggccggc ttcatcacga acatcggccc gctgatgctc      2340
     gacggcgccc gctccgaccc caccaagggc gacacgccgc gcaccgccac ccccgcgccc      2400
     gacgccgcga aggcgctggc cgaccggctg ggcgcgaccg tcggcggcaa gaccctcgcg      2460
     ccccaggccg cgaaggtcct cggcgaggtc aagtccgtcc cgctcgacca gctgatcgag      2520
     aacatgatgc agctgtcgga caacgtgctc gccgagacgc tggcccgcga ggtcgccaag      2580
     gcgcgcaacg ccgagacctc ctacgagggc gccaccaagg ccgtgcggga cgtgctcacc      2640
     gagaacggct tcgacctgac cggcgtcatc acctccgacg ccagcggcat gagcgtgcag      2700
     aacaaggtcc ccgccaagct cctcggcgac ctgctcaccg ccgccgcgcg ccccgacgcc      2760
     gccaccgacc cggtcaccac ccgcctgcgc ccgctgctca ccgccctcgc cgtcgcgggc      2820
     ggcaacggca ccctgaagga gcggttcgcg cagtcccccg cgggcaaggg ctggatccgg      2880
     ggcaagaccg gcacgctcac cgaggtgcac agcctcgcgg gcgtcgtggt ggacaccgac      2940
     ggcaggctgc tggtgttcgc gttcatgtcc aacggcagcg gcgacgccct cggggcgcgc      3000
     gccgggctcg acgcgctggc cgcccagctc aggggttgcg gctgttcgtg a               3051
//

If you have problems or comments...

PBIL Back to PBIL home page