(data stored in ACNUC7421 zone)

EMBL: CP001630.PE304

CP001630.PE304       Location/Qualifiers
FT   CDS_pept        338032..339045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0309"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34278"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="InterPro:IPR022454"
FT                   /db_xref="InterPro:IPR042271"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG2"
FT                   /inference="protein motif:COG:COG5282"
FT                   /protein_id="ACU34278.1"
FT                   /translation="MTQQDRAASIDWEVAVSTAARLVRPGPVVPRAEADVAVGRLRELA
FT                   VDAEAHVRELTGLGHGLPLRAGEVVDRPGWVRAAAQGLSVLTDSAAPRQGGVLSGVVSG
FT                   TAGVQAGVVLAFLSSRVLGQYDPFSGDGRLLLVAPNIVGTQRALNVPGEDFSMWVCLHE
FT                   CTHRLQFTGVPWLAGHFSGLVTELLESMDNESPRLRDLPKRLREADGPVGLIELFQTPE
FT                   QRAALDRLIAVSTLLEGHADHVMDAVGPDVVPSVAVIRRRFTDRRSGGGLLDRVLRSLL
FT                   GVEAKVRQYAEGAAFTRHVVDEVGMTGFNAVWSAPEALPTRAEIADPAAWLRRVAP"
     gtgactcagc aggaccgggc ggcgtcgatc gactgggagg tcgccgtctc cacggcggcc        60
     cgcctggtcc gccccggacc ggtggtgccc agggccgagg ccgacgtcgc ggtcggcagg       120
     ctgcgcgagc tggcggtgga cgccgaggcg cacgtccggg agctgacggg cctcggccac       180
     gggctgccgc tgcgcgcggg cgaggtcgtc gaccggccgg gctgggtgcg cgccgcggcc       240
     caggggctgt cggtgctcac cgacagcgcc gcgccccggc agggcggcgt gctcagcggg       300
     gtcgtgtcgg gcacggcggg ggtgcaggcg ggcgtggtgc tcgcgttcct cagctcccgc       360
     gtgctcggcc agtacgaccc gttctccggc gacggcaggc tgctgctggt cgccccgaac       420
     atcgtcggca cccagcgcgc gctgaacgtg cccggcgagg acttcagcat gtgggtgtgc       480
     ctgcacgagt gcacccaccg gctccagttc accggcgtcc cgtggctggc cgggcacttc       540
     tccggcctgg tcaccgagct gctggagagc atggacaacg agtcgccccg gctgcgcgac       600
     ctgcccaagc ggctgcgcga ggcggacggg ccggtcgggc tgatcgagct gttccagacg       660
     cccgagcagc gcgccgcgct cgaccggctg atcgcggtgt ccaccctgct ggaggggcac       720
     gccgaccacg tcatggacgc ggtcgggccg gacgtggtgc cgtccgtcgc ggtgatccgg       780
     cggcggttca ccgaccggcg ctccgggggt gggctgctgg accgggtgct gcgctcgctg       840
     ctgggcgtgg aggccaaggt caggcagtac gcggagggcg ccgcgttcac caggcacgtg       900
     gtggacgagg tcggcatgac cgggttcaac gcggtgtgga gcgcccccga ggcgctgccg       960
     acccgcgccg agatcgccga ccccgccgcc tggctgcgcc gcgtcgcgcc gtga            1014
//

If you have problems or comments...

PBIL Back to PBIL home page