(data stored in ACNUC7421 zone)

EMBL: CP001630.PE305

CP001630.PE305       Location/Qualifiers
FT   CDS_pept        339042..339968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0310"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein; KEGG: ade:Adeh_1494
FT                   tRNA(Ile)-lysidine synthetase- like"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34279"
FT                   /db_xref="GOA:C6WGG3"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG3"
FT                   /inference="protein motif:TFAM:TIGR02432"
FT                   /protein_id="ACU34279.1"
FT                   /translation="MTPAANGPLSRVRTAVRRFLAEHRPARVAVAVSGGADSLALAACT
FT                   AALTSGARAVVVDHGLQEGSAEVAERAARTCAELGLDAQVRRVEVTGGGGPEAAARRAR
FT                   YAALRPERGLVLLGHTLDDQAETVLLGLGRGSGPRSIAGMRELDAPWGRPLLGVSRADT
FT                   EGACAELGLSPWSDPHNADPAFTRVRLRREVLPLLEEVLQGGVARALARTAAQLREDND
FT                   ALDDLADAFAGDRGAVADLAPLPVALRRRVLRRWLLAEGVPELSDSHLRAVDALVRTGA
FT                   GGGGVWVPGGFVVRRARGRLRVDPVQA"
     gtgaccccgg ccgccaacgg gccgctgtcg cgggtccgga cggcggtgcg gcggttcctc        60
     gccgagcacc gccccgcgcg ggtcgcggtg gcggtgtccg gcggggccga ctcgctggcg       120
     ctcgccgcct gcaccgccgc gctgaccagc ggcgcgcggg ccgtcgtggt cgaccacggg       180
     ctccaggagg gctcggccga ggtcgccgag cgggccgccc gcacgtgcgc cgagctgggc       240
     ctggacgcgc aggtgcggcg ggtcgaggtg accgggggcg gcggcccgga ggcggcggcc       300
     cggcgcgccc ggtacgccgc gctgcgcccc gagcgcggcc tggtgctgct cgggcacacc       360
     ctggacgacc aggccgagac cgtgctgctg ggcctcggcc ggggctccgg gccccgctcg       420
     atcgccggga tgcgcgagct ggacgcgccg tggggccgcc cgctgctggg cgtgagcagg       480
     gcggacaccg agggcgcctg cgccgagctg ggcctttccc cgtggtcgga cccgcacaac       540
     gccgaccccg cgttcaccag ggtgcggctg cgccgcgagg tgctgccgct gctggaggag       600
     gtgctgcagg gcggggtggc gcgggcgctg gcccgcaccg ccgcccagct gcgcgaggac       660
     aacgacgcgc tggacgacct cgcggacgcg ttcgcgggcg accggggcgc ggtcgcggac       720
     ctcgcgccgc tgccggtggc cctgcgcagg cgggtgctgc ggcggtggct gctcgccgag       780
     ggtgtgcccg agttgtccga ttcgcacctg cgcgcggtgg acgccctcgt gcggaccggc       840
     gccggtggtg gtggggtgtg ggtacccggc ggctttgtgg tgcgccgggc acgtggcagg       900
     ctgcgggttg acccagtcca ggcatga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page