(data stored in ACNUC7421 zone)

EMBL: CP001630.PE306

CP001630.PE306       Location/Qualifiers
FT   CDS_pept        339985..340533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0311"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="KEGG: spe:Spro_3998 hypoxanthine
FT                   phosphoribosyltransferase; TIGRFAM: hypoxanthine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34280"
FT                   /db_xref="GOA:C6WGG4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG4"
FT                   /inference="protein motif:TFAM:TIGR01203"
FT                   /protein_id="ACU34280.1"
FT                   /translation="MYDGDIASVLLSEQEISDKVGELARQVAADYPAGGDDLVLITVLK
FT                   GAVMFTSDLARALPVPVQLEFMAVSSYGSSTSSSGVVRILKDLDRDIADRDVLIVEDII
FT                   DSGLTLSWLLKNLASRKPRSMEVCTLLRKPDAVKVDVPVKYVGFDIPNEFVVGYGLDYA
FT                   ERYRDLPYIGKLDPKVYSG"
     gtgtacgacg gcgacatcgc ctccgtgctc ctcagcgagc aggagatcag cgacaaggtc        60
     ggtgagctgg cccgtcaggt ggccgccgac tacccggcag gcggtgacga cctcgtcctc       120
     atcaccgtcc tcaagggcgc ggtgatgttc acctccgacc tggccagggc gcttcccgtc       180
     ccggtgcagc tggagttcat ggcggtcagc tcctacgggt cctccacgtc ctcctcgggc       240
     gtggtgcgca tcctcaagga cctcgaccgc gacatcgcgg accgggacgt cctcatcgtc       300
     gaggacatca tcgactccgg gctgacgctg tcctggctgc tcaagaacct cgcctcgcgc       360
     aagccgcgct cgatggaggt ctgcacgctg ctgcgcaagc ccgacgcggt gaaggtcgac       420
     gtgccggtga agtacgtcgg cttcgacatc cccaacgagt tcgtggtcgg ctacggcctc       480
     gactacgccg agcggtaccg cgacctgccg tacatcggca agctggaccc gaaggtctac       540
     tccggctga                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page