(data stored in ACNUC7421 zone)

EMBL: CP001630.PE307

CP001630.PE307       Location/Qualifiers
FT   CDS_pept        complement(340597..342291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0312"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; SMART: von
FT                   Willebrand factor type A; KEGG: dac:Daci_0766 von
FT                   Willebrand factor type A"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34281"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG5"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ACU34281.1"
FT                   /translation="MSARSERPGRARRIALPLGALVGVLAAGATAVVALKATSGPDCTG
FT                   TLPLKVATTPAAEAVVRGAADDYQATQPVVDGRCVQVQVEARTAADVAHELPTARINPP
FT                   VMWVPDSTMWAEEAQRQSASLGAEAPALEVGEPLAGSPLVIAGPAEKLRGLGWPSTSVA
FT                   WASVLAPGVEAAVSDPTTSTEGLATLAVIRARLGNADGTPNQELIGSLMRIGRNAVTVR
FT                   DSFNRVGQDEGSAPLFTASEQAVLAANRAAGGLRVAASYPAEGTMLLDYPVVRIKRASD
FT                   QPGTGVAASGFEQALRSAKTRERFVDAGFRTPDGQAAAGLSAERDGVGGDAVNAMPKPS
FT                   PAEVSELLGTWGAVSLDSRMLAVLDVSGSMTELMGNGQTRMAAASEAALTALGMLPDTS
FT                   EIGLWAFSTNKRPPNDWVELVPLGPLGEVLGSAPRRTRLQQGAKGLAALVGGGTALNDT
FT                   TLAAFRRMQSTYDPEKINSVVLITDGRNDDYASITTAQLLQALESESDPARPIPLIMVG
FT                   LGQEADMEALQEISSATGGKAYQALEAADIRSVLLDAISQRRCRPNC"
     atgtcagccc gcagcgaacg ccccggccgc gcccggcgga tcgcactgcc cctgggggcc        60
     ctggtcggcg tgctcgccgc gggggccacc gccgtggtcg cgctgaaggc gaccagcggc       120
     ccggactgca ccggcaccct cccgctcaag gtcgccacca ccccggccgc cgaggcggtc       180
     gtgcgcggcg cggccgacga ctaccaggcc acccagcccg tcgtggacgg ccggtgcgtg       240
     caggtccagg tcgaggcgcg caccgccgcc gacgtggcgc acgagctgcc gaccgcccgg       300
     atcaacccgc ccgtcatgtg ggtcccggac tcgaccatgt gggccgagga ggcccagcgc       360
     cagtccgcga gcctgggcgc cgaggcgccc gcgctggagg tcggcgagcc gctggccggg       420
     tccccgctgg tcatcgcggg tccggcggag aagctgcgcg ggctgggctg gccgagcacc       480
     tcggtcgcct gggccagcgt gctcgcgccc ggcgtggagg ccgcggtgag cgacccgacc       540
     acctccaccg agggcctggc caccctggcg gtcatccgcg ccaggctcgg caacgcggac       600
     ggcacgccca accaggagct gatcggctcg ctgatgcgga tcgggcgcaa cgccgtgacc       660
     gtgcgcgact ccttcaaccg ggtcggccag gacgagggga gcgcgccgct gttcaccgcc       720
     tccgagcagg ccgtgctggc cgcgaaccgg gcggccggcg ggctgcgggt cgccgcctcc       780
     tacccggccg agggcacgat gctgctcgac tacccggtgg tgcggatcaa gcgcgcctcc       840
     gaccagccgg gcaccggggt cgcggcgagc ggcttcgagc aggcgctgcg cagcgccaag       900
     acccgcgagc ggttcgtgga cgcgggcttc cgcaccccgg acgggcaggc ggcggccggg       960
     ctgtcggccg agcgcgacgg ggtcggcggc gacgcggtga acgcgatgcc gaagccgagc      1020
     ccggccgagg tgtccgagct gctgggcacc tggggcgcgg tgagcctgga ctcgcggatg      1080
     ctcgcggtgc tggacgtgtc cggctcgatg accgagctga tgggcaacgg ccagacccgc      1140
     atggcggcgg cgtccgaggc ggcgctgacc gcgctgggga tgctgccgga cacctcggag      1200
     atcggcctgt gggcgttctc cacgaacaag aggccgccga acgactgggt cgagctggtg      1260
     ccgctcggcc cgctcggcga ggtgctgggc agcgcgccga ggcggacgcg gctccagcag      1320
     ggcgccaagg gcctggcggc gctggtcggc ggcgggaccg cgctgaacga caccacgctc      1380
     gcggcgttcc ggaggatgca gtccacgtac gaccccgaga agatcaactc agtggtgctg      1440
     atcaccgacg gccgcaacga cgactacgcc agcatcacca ccgcgcagct gctgcaggcg      1500
     ctggagtcgg agtccgaccc ggcgcgcccg atcccgctga tcatggtcgg gctgggccag      1560
     gaggccgaca tggaggcgct gcaggagatc tcctcggcca ccggcggcaa ggcctaccag      1620
     gcgctggagg cggccgacat ccgcagcgtg ctgctggacg cgatctccca gcggcggtgc      1680
     aggcccaact gctga                                                       1695
//

If you have problems or comments...

PBIL Back to PBIL home page