(data stored in ACNUC7421 zone)

EMBL: CP001630.PE308

CP001630.PE308       Location/Qualifiers
FT   CDS_pept        342757..344988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0313"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="KEGG: bcy:Bcer98_0060 ATP-dependent metalloprotease
FT                   FtsH; TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; peptidase M41 FtsH extracellular; AAA ATPase
FT                   central domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34282"
FT                   /db_xref="GOA:C6WGG6"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG6"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ACU34282.1"
FT                   /translation="MDRKRLLRNPLLWIVAVVLLFYVFSVLFDEDRNYHQVTTSQALQQ
FT                   VRDGKVKEATIEDKEQKLKLVLNDGSTFENHGLLMASYPASATDEVFTLVDQAGNKPQV
FT                   ETKVTQDSLLTQMLLYLVPLGLLLLLLMWMMNNAQGGGNRVLNFGKSKAKQLSKDMPKT
FT                   TFADVAGAEEAVEELYEIKDFLQNPGRYQALGAKIPKGVLLYGPPGTGKTLLARAVAGE
FT                   AGVPFYSISGSDFVEMFVGVGASRVRDLFEQAKQNAPCIIFVDEIDAVGRHRGAGMGGG
FT                   HDEREQTLNQLLVEMDGFDSRGGIILIAATNRPDILDPALLRPGRFDRQIPVSAPDLKG
FT                   RKQILRVHAKGKPLAPDTDLDGLAKRTVGFSGADLANVINEAALLTARQNGTVIDGSAL
FT                   EESVDRVIGGPARKSRIISEKEKKITAYHEAGHALAAWAMPDIDPVYKVTILARGRTGG
FT                   HTLSVPEEDKDLMTRSEMIARLVFALGGRSAEELVFHEPTTGASNDIEQATKIARAMVT
FT                   EYGMSSRLGAVKYGQEQGEPFLGRNAGRQADYSLEVAHEIDEEVRKLIEAAHTEAYEVL
FT                   NTYRDVLDDLTLELIDKETLHQKDLERIFAGVEKRPRITQFNDFGNRIPSTKPPVKTPG
FT                   ELARERGEPWPPVVEDQVEAEPAALPAPAPETPQGPAQPQQVPAGANGVQHPPQQVTPG
FT                   SGPPNYGAPPGWTPATVPGSGGQPTTPAWRPDPADADKRNFDSDPDNRK"
     atggaccgca agcgcctgct tcgcaacccg ctgctgtgga tcgtggcggt ggtgctcctc        60
     ttctacgtct tcagcgtgct cttcgacgag gaccggaact accaccaggt cacgacctcc       120
     caagccctcc aacaggtgcg ggacgggaag gtcaaggaag ccacgatcga ggacaaggag       180
     cagaagctca aactcgtcct caacgacggt tccaccttcg agaaccacgg cctcctgatg       240
     gcctcgtacc cggccagtgc cacggacgag gtgttcaccc tggtcgacca ggcgggcaac       300
     aagccgcagg tcgagaccaa ggtgacccag gactccctgc tcacgcagat gctcctgtac       360
     ctggtgccgc tggggctgct gctcctgctg ctgatgtgga tgatgaacaa cgcccagggt       420
     ggcgggaacc gcgtcctcaa cttcggcaag tccaaggcaa agcagctctc caaggacatg       480
     cccaagacga cgttcgccga cgtcgcggga gccgaggagg cggtggagga gctctacgag       540
     atcaaggact tcctccagaa ccccggccgc taccaggcgc tcggggcgaa gatcccgaag       600
     ggcgtcctgc tctacgggcc ccccggcacc ggcaagaccc tgctggccag ggccgtcgcc       660
     ggtgaggcgg gcgtgccgtt ctactcgatc tccggctcgg acttcgtcga gatgttcgtc       720
     ggcgtcggcg cctcgcgcgt gcgcgacctg ttcgagcagg ccaagcagaa cgcgccctgc       780
     atcatcttcg tcgacgagat cgacgcggtg ggccgccacc gcggcgcggg catgggcggc       840
     gggcacgacg agcgcgagca gacgctcaac cagctgctcg tggagatgga cggcttcgac       900
     tcgcgcggcg ggatcatcct gatcgcggcg accaaccggc ccgacatcct cgaccccgcc       960
     ctgctgcgcc ccggccgctt cgaccggcag atcccggtgt ccgcgccgga cctgaagggc      1020
     cgcaagcaga tcctccgggt gcacgccaag ggcaagccgt tggcccctga caccgacctc      1080
     gacggcctgg ccaagcgcac cgtcgggttc tccggagccg acctggccaa cgtcatcaac      1140
     gaggccgcgc tgctcaccgc ccgccagaac ggcaccgtca tcgacggctc cgcgctggag      1200
     gagtcggtcg accgcgtcat cggcggtccc gcccgcaaga gccggatcat ctccgagaag      1260
     gagaagaaga tcacggccta ccacgaggcg ggccacgcgc tggccgcgtg ggcgatgccg      1320
     gacatcgacc cggtctacaa ggtcaccatc ctcgccaggg ggcgcaccgg cggtcacacg      1380
     ctgtccgtcc ccgaggagga caaggacctg atgaccaggt ccgagatgat cgcccggctg      1440
     gtgttcgcgc tcggtggccg ctcggcggag gagctcgtct tccacgagcc caccaccggc      1500
     gcgtccaacg acatcgagca ggcgaccaag atcgcccgcg cgatggtcac cgagtacggc      1560
     atgagctccc gcctcggcgc cgtcaagtac ggccaggagc agggcgagcc gttcctcggc      1620
     cgcaacgccg gtcgccaggc cgactactcg ctggaggtcg cgcacgagat cgacgaggag      1680
     gtgcgcaagc tcatcgaggc cgcccacacg gaggcctacg aggtgctgaa cacctaccgc      1740
     gacgtcctcg acgacctgac gctggagctg atcgacaagg agacgctcca ccagaaggac      1800
     ctggagcgga tcttcgcggg cgtcgagaag cgcccccgga tcacccagtt caacgacttc      1860
     ggcaaccgca tcccgtcgac caagccgccg gtcaagaccc ccggcgagct ggccagggag      1920
     cgcggcgagc cgtggccgcc ggtggtcgag gaccaggtcg aggccgagcc cgcggcactg      1980
     cccgcgcccg cacccgagac cccgcaggga ccggcccagc cgcagcaggt ccccgctggc      2040
     gccaacggcg tccagcaccc gccgcagcag gtcacccccg gctcggggcc gcccaactac      2100
     ggggcgcccc ccggctggac cccggccacc gtgccgggca gcgggggcca gccgaccaca      2160
     cccgcgtggc ggccggaccc ggcggacgcg gacaagcgga acttcgactc ggacccggac      2220
     aaccgcaagt ga                                                          2232
//

If you have problems or comments...

PBIL Back to PBIL home page