(data stored in ACNUC7421 zone)

EMBL: CP001630.PE309

CP001630.PE309       Location/Qualifiers
FT   CDS_pept        344985..345614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0314"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="KEGG: bha:BH1646 GTP cyclohydrolase I; TIGRFAM: GTP
FT                   cyclohydrolase I; PFAM: GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34283"
FT                   /db_xref="GOA:C6WGG7"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG7"
FT                   /inference="protein motif:TFAM:TIGR00063"
FT                   /protein_id="ACU34283.1"
FT                   /translation="MIEFDNAGLPSNGEAGVAAKRPFDQERAEAAVRELLLACGEDPER
FT                   EGLRETPARVARAYREMFAGLFTEPDGVLAKTFDESHEELVLVTEIPVYSFCEHHLLPF
FT                   HGVAHVGYIPNEQGRVTGLSKLARLVDLYAKRPQVQERLTSQVADALVRRLEPRGVIVV
FT                   VEAEHLCMGMRGVRKPGSRTTTSAVRGLLRTSASSRAEAISLIKGR"
     gtgatcgaat tcgacaacgc cggtctcccc agcaacgggg aggccggcgt cgccgcgaag        60
     cggcccttcg accaggagcg cgccgaggcc gccgtgcgcg agctgctgct cgcctgcggc       120
     gaggaccccg agcgcgaggg actgcgcgag acgcccgcgc gggtcgcgcg ggcctaccgc       180
     gagatgttcg ccggcctgtt caccgagccg gacggcgtgc tggccaagac cttcgacgag       240
     agccacgagg aactcgtcct ggtcacggaa atcccggtct actcgttctg cgagcaccac       300
     ctgctgccgt tccacggcgt cgcgcacgtc gggtacatcc cgaacgagca gggccgcgtc       360
     accgggctgt ccaagctggc ccggctggtc gacctgtacg ccaagcgccc ccaggtgcag       420
     gagcggctga cctcgcaggt cgccgacgcg ctcgtgcgca ggctggagcc gcgcggcgtc       480
     atcgtcgtgg tcgaggccga gcacctgtgc atggggatgc gcggcgtgcg caagcccggc       540
     tcgcgcacca ccacctccgc cgtgcgcggc ctgctgcgca cctcggcgtc ctcgcgcgcc       600
     gaggccatct ccctgatcaa ggggcgctga                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page