(data stored in ACNUC7421 zone)

EMBL: CP001630.PE31

CP001630.PE31        Location/Qualifiers
FT   CDS_pept        34677..35864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0031"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   bur:Bcep18194_B3007 amino acid aldolase or racemase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34005"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI4"
FT                   /inference="protein motif:PFAM:PF01168"
FT                   /protein_id="ACU34005.1"
FT                   /translation="MQPRTRLDLATKDLEAPLAIVDLDAFDHNAADLVRRAGGKPIRVA
FT                   SKSVRVRALLDRVLARPGYAGLMCYSLPEALWLSSCDTAEDLLVAYPTVDHAALRALAA
FT                   DKKARGRVTIMVDSTAHLDLVDAALGEDHPEIRVCLELDVSWRPLPGLHVGPRRSPVHT
FT                   EGDAVRLARAVVARKGFRLVGVMAYEGQVAGIGDAPAGRRAWGLAVRWMQGRSVPELTE
FT                   RRAAAVAAVRRVADLEFVNGGGTGSLETTGADRSVTELAAGSGLVGPTLFDAYRAFSPR
FT                   PAALFALPVVRRPKKNVATLFAGGYVASGTGTPDRLPSPHLPSGLELIGLEGAGEVQTP
FT                   VVGKAADRLELGDRVWLRHAKAGELAERFAEYHLVSGDRVEAVVPTYRGEGKAFG"
     atgcagccga ggacgcgact cgacctggcg accaaggacc tcgaagcccc gctcgcgatc        60
     gtcgacctgg acgcgttcga ccacaacgcg gccgacctcg tccggcgggc cgggggcaag       120
     cccatccgcg tggcgagcaa gtcggtccgg gtgcgggcgc tgctcgaccg ggtcctcgcc       180
     aggccgggct acgccgggct gatgtgctac tcgctgcccg aggcgctctg gctgtcgtcc       240
     tgcgacaccg ccgaggacct gctggtcgcg tacccgaccg tcgaccacgc cgcgctgcgc       300
     gcgctggccg ccgacaagaa ggcccgcgga cgcgtcacga tcatggtcga ctcgaccgcg       360
     cacctcgacc tggtcgacgc cgccctcggc gaggaccacc cggagatccg ggtgtgcctg       420
     gagctggacg tctcgtggcg accgctgccc ggcctgcacg tcggaccgcg ccgctcgccg       480
     gtgcacaccg agggcgacgc cgtccggctc gcccgcgcgg tcgtggccag gaagggcttc       540
     cggctggtcg gcgtcatggc ttacgagggc caggtggcgg gcatcggcga cgcgcccgcc       600
     ggtcggcgcg cctggggcct ggcggtgcgc tggatgcagg gccgctcggt gccggagctg       660
     accgagcgca gggccgccgc ggtggccgcg gtgcgccggg tggccgacct ggagttcgtc       720
     aacggcggcg ggaccgggag cctggagacg accggcgccg accggtcggt gaccgagctg       780
     gctgcggggt ccgggctggt cgggccgacc ctgttcgacg cctaccgcgc gttcagcccg       840
     cgcccggccg cgctgttcgc gctgcccgtg gtgcgcaggc ccaagaagaa cgtcgccacg       900
     ctgttcgcgg gcgggtacgt ggcgtcgggg accgggacgc cggaccggct gccctcgccg       960
     cacctgccga gcgggctgga gctgatcggg ctggagggcg ccggggaggt gcagacgccg      1020
     gtcgtcggga aggccgcgga ccggttggag ctgggggacc gggtctggct gcgccacgcg      1080
     aaggcgggcg agctggccga gcggttcgcg gagtaccacc tggtgagcgg ggaccgggtc      1140
     gaggccgtcg tgccgaccta ccggggcgag ggcaaggcct tcggctag                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page