(data stored in ACNUC7421 zone)

EMBL: CP001630.PE310

CP001630.PE310       Location/Qualifiers
FT   CDS_pept        345653..346438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0315"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: afw:Anae109_2337 dihydropteroate synthase;
FT                   TIGRFAM: dihydropteroate synthase; PFAM: dihydropteroate
FT                   synthase DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34284"
FT                   /db_xref="GOA:C6WGG8"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG8"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ACU34284.1"
FT                   /translation="MGVLNVTADSFSDGGRYLGLADAVAHGLALRDQGAHLVDVGGEST
FT                   RPGAERVPSDLEVARTSHVIAALSAQGVVTSVDTTRSEVAVAALEAGVSVVNDVSGGLA
FT                   DPDMLRVVAEADVPYVVMHWRGHSAGMDRLAEYSDVVREVRDELSARVDAALAAGVRAE
FT                   NVVVDPGLGFAKRAEHNWQLLNRLDELIDLGFPVLVGASRKRFLGALLGERPPAGREDA
FT                   TAAVSALAAFNGAWGVRVHDVPRSVDAVAVAGAWRAGRG"
     atgggcgtcc tgaacgtcac cgccgactcg ttctccgacg gcggtcgcta cctgggcctt        60
     gccgacgccg tcgcgcacgg gctggccctg cgcgaccagg gcgcgcacct ggtcgacgtg       120
     ggcggcgagt ccaccaggcc aggagccgag cgggtgccga gcgacctgga ggtcgcccgc       180
     acctcgcacg tgatcgccgc gctgtccgcg cagggggtgg tgaccagcgt ggacaccacc       240
     cgctccgagg tggccgtcgc cgcgctggag gccggggtgt cggtggtcaa cgacgtgtcc       300
     ggcggcctgg ccgacccgga catgctgagg gtcgtcgccg aggcggacgt gccgtacgtg       360
     gtcatgcact ggcgcgggca cagcgcaggc atggaccggc tcgccgagta ctccgacgtg       420
     gtgcgggagg tccgcgacga gctgtccgcc cgcgtggacg ccgccctcgc cgccggggtg       480
     cgggccgaga acgtggtggt cgaccccggc ctgggcttcg cgaagcgcgc cgagcacaac       540
     tggcagctgc tgaaccggct ggacgagctg atcgacctcg gcttcccggt gctggtcggc       600
     gcctcccgca agcggttcct cggcgccctg ctgggcgagc ggcccccggc gggccgggag       660
     gacgcgacgg cggccgtgtc ggcgctggcc gcgttcaacg gcgcctgggg cgtgcgggtg       720
     cacgacgtgc cgcgctcggt ggacgcggtg gccgtcgcgg gcgcgtggcg ggccggtcgt       780
     ggctga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page