(data stored in ACNUC7421 zone)

EMBL: CP001630.PE311

CP001630.PE311       Location/Qualifiers
FT   CDS_pept        346431..346808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0316"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; PFAM:
FT                   dihydroneopterin aldolase; KEGG: oca:OCAR_6643
FT                   dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34285"
FT                   /db_xref="GOA:C6WGG9"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG9"
FT                   /inference="protein motif:TFAM:TIGR00525"
FT                   /protein_id="ACU34285.1"
FT                   /translation="MAEATGSGDRIELRGLTVRAHHGVFEHEKRDGQDFLVDVVVWLDL
FT                   TRAAATDDLRETLHYGELAERVAEVVAGGPHDLIETVAGRAADVVMADGRVTATEVTVH
FT                   KPHAPIPLIFADVAVTVRRTR"
     gtggctgagg cgacggggtc cggcgaccgg atcgagctgc gcggcctgac ggtgcgcgcg        60
     caccacggcg tgttcgagca cgagaagcgc gacggccagg acttcctggt cgacgtggtg       120
     gtgtggctgg acctgacccg cgccgccgcc accgacgacc tgcgcgagac cctgcactac       180
     ggcgagctgg ccgagcgggt cgccgaggtc gtcgcgggcg ggccgcacga cctcatcgag       240
     accgtcgccg gacgcgccgc cgacgtggtc atggccgacg ggcgggtcac cgcgaccgag       300
     gtgaccgtcc acaagccgca cgcgccgatc ccgctgatct tcgccgacgt ggcggtgacc       360
     gtgcggagga cccggtga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page