(data stored in ACNUC7421 zone)

EMBL: CP001630.PE312

CP001630.PE312       Location/Qualifiers
FT   CDS_pept        346805..347281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0317"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridin
FT                   epyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="KEGG: mex:Mext_1812 2-amino-4-hydroxy-6-
FT                   hydroxymethyldihydropteridine pyrophosphokinase;
FT                   TIGRFAM:2-amino-4-hydroxy-6-hydroxymethyldihydropter
FT                   idinepyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin- pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34286"
FT                   /db_xref="GOA:C6WGH0"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH0"
FT                   /inference="protein motif:TFAM:TIGR01498"
FT                   /protein_id="ACU34286.1"
FT                   /translation="MSRAVLSLGSNLGDRLAHLRSAVDGFRPWLLAASPVYETAPWGVT
FT                   DQDDFLNAVLLVEGDLDEWGWLRRGQELERAAGRVRERRWGPRTLDVDVVAVDDVRSED
FT                   PELLLPHPGAHERATVLAPWLDVDPDAVLPGHGRVADLLSGVDLSGVRRLEVAL"
     gtgagccgcg ccgtgctgtc cctcggctcc aacctcggcg accggctcgc ccacctgcgc        60
     tcggccgtcg acggcttccg gccgtggctg ctcgccgcct ccccggtgta cgagaccgcc       120
     ccgtggggcg tcaccgacca ggacgacttc ctcaacgccg tcctgctcgt cgagggcgac       180
     ctggacgagt ggggctggct gcgccggggc caggagctgg agcgggccgc cgggcgggtc       240
     agggagcgcc gctgggggcc gcgcacgctc gacgtggacg tggtggccgt ggacgacgtg       300
     cggtccgagg accccgagct gctgctgccg caccccggcg cgcacgagcg ggccaccgtg       360
     ctggcgccct ggctggacgt cgacccggac gcggtgctgc cggggcacgg gcgggtcgcc       420
     gacctgctgt ccggggtgga cctgtccggg gtgcggaggc tggaggtcgc gctgtga          477
//

If you have problems or comments...

PBIL Back to PBIL home page