(data stored in ACNUC7421 zone)

EMBL: CP001630.PE313

CP001630.PE313       Location/Qualifiers
FT   CDS_pept        347278..347730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0318"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_2860 cytochrome c oxidase subunit
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34287"
FT                   /db_xref="GOA:C6WGH1"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34287.1"
FT                   /translation="MTFTKGRDLLAAGLGSAALVFLLLKLSYSGLPPLPRLAGLVLLVI
FT                   AAIDLGLAVSLRARILRKPGAEPVQPLTAARAVALAKASSVLGAIMAGAWGAVLLHVAP
FT                   ARGRFPAADNDLTSAVVGLVCAAALTASGLWLERCCRTPDEPERRA"
     gtgacgttca ccaaagggcg cgacctgctc gcggccgggc tcggctcggc cgccctggtc        60
     ttcctgctgc tcaagctctc ctactccggg ctgccgccgc tgcccaggct cgccgggctg       120
     gtcctgctgg tgatcgccgc gatcgacctc ggtctcgcgg tgtcgctgcg cgcccgcatc       180
     ctgcgcaagc ccggcgccga accggtgcag ccgctcaccg ccgcccgcgc cgtcgcgctc       240
     gccaaggcct cctcggtgct gggcgcgatc atggcgggcg cgtggggcgc ggtgctgctg       300
     cacgtggccc ccgcgcgggg ccgcttcccc gcggcggaca acgacctgac cagcgccgtg       360
     gtgggactcg tgtgcgctgc ggcgctgacc gcctccggac tgtggttgga gcgctgctgc       420
     cgaaccccgg acgagcccga gcgccgagcg tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page