(data stored in ACNUC7421 zone)

EMBL: CP001630.PE314

CP001630.PE314       Location/Qualifiers
FT   CDS_pept        347781..349451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0319"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mgm:Mmc1_2162 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34288"
FT                   /db_xref="GOA:C6WGH2"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34288.1"
FT                   /translation="MTGRAPSRDDEQQEHGRGSARLLLVAALAFALVAAAVLVLSDNAR
FT                   WLRLAVVSALWAALVGAFLAARYRRQVADREDEVADLQNVYELELEREVAARREFELEL
FT                   ETEAHRKAQEDAKDDLDALRGELRALRENLEALLGGEVLVERVALRAEATRMRSLGDQS
FT                   RLDQSRLVSAMNEHRVITSGKAKKDDQPSVVDLDPAEQTELIERVTDAQPARRVEPVRR
FT                   EAARAEPVRRDPVRSGTRPPQPKSAAPAAPKQAVQPPGVKRAQPKAEPQRPAAQAKPAA
FT                   AQAAPTAQVAHPAKQQQPRPAEGTAQDYFTDQSARGGAAASRGQGEPVKTAESQRRSRI
FT                   AERTEMISRDSVAEERPARPAAGGLTASEQSGVRRSVAGGRPAAAEQGAQQARRPAAAT
FT                   GRTASEQSGVRRGVAGGRSASEQSGVRRPAAAAGRSASEQSAVRRPVAGGLSASEQAGG
FT                   VRRAVAGGRSASEQSTTRRPVADEATPHAPQPEQPEQAAGGRRRADPRDEAPQPAAGRR
FT                   AAPEPDPAAGAHADGKSVSELLAAFGGGDSPRRRRRRED"
     atgaccgggc gagccccgtc gagagacgac gagcagcaag aacacggtcg tggctccgcg        60
     cgcctcctgc tggtcgcagc actggcgttc gccctcgttg ccgcggccgt gctggtgctg       120
     agtgacaacg cccgctggtt gaggctggcc gtggtgtcgg cgctgtgggc cgcgctcgtg       180
     ggcgccttcc tggccgcgcg ctaccgccgc caggtggccg accgcgagga cgaggtggcc       240
     gacctccaga acgtgtacga gctggagctg gagcgcgagg tcgccgcgag gcgcgagttc       300
     gagctggagc tggagaccga ggcccaccgc aaggcgcagg aggacgcgaa ggacgacttg       360
     gacgcgctgc gcggcgagct gcgcgcgctg cgcgagaacc tggaggcgct gctgggcggc       420
     gaggtgctgg tcgagcgggt ggcgctgcgg gcggaggcca cgcggatgcg ctcgctgggc       480
     gaccagtccc ggttggacca gtcccgcctg gtgtccgcca tgaacgagca ccgggtcatc       540
     acctcgggca aggcgaagaa ggacgaccag ccgtccgtgg tcgacctgga cccggcggag       600
     cagaccgagc tgatcgagcg cgtcaccgac gcgcagccgg cccgcagggt cgagccggtg       660
     cgccgcgagg cggcccgcgc cgaacccgtg cgccgcgacc cggtccgcag cggcaccagg       720
     ccgccgcagc cgaagtccgc cgcgcccgcc gcgccgaagc aggccgtgca gccgccgggc       780
     gtgaagcgcg cccagccgaa ggcggaaccg cagcgacccg ccgcccaggc gaagcccgcg       840
     gcggcccagg ccgcgccgac ggcgcaggtg gcgcaccccg ccaagcagca gcagccgagg       900
     cccgccgagg gcacggcgca ggactacttc accgaccagt cggcgcgcgg tggcgcggcg       960
     gcctcgcgcg gtcagggcga gcccgtgaag acggcggagt cgcagcggcg cagccggatc      1020
     gccgagcgca ccgagatgat cagccgcgac tcggtggccg aggagcgccc cgcccgcccg      1080
     gcggcgggcg ggctgaccgc gtccgagcag tcgggcgtgc gcaggtccgt cgcgggtgga      1140
     cgcccggcgg cggccgagca gggtgcgcag caggcaaggc gtcccgccgc ggcgacgggc      1200
     cggacggcgt ccgagcagtc gggcgtgcgg cggggcgtcg cgggcgggcg ttccgcctcg      1260
     gagcagtcgg gcgtgcgacg cccggcggcg gcagcgggcc ggtcggcctc ggagcagtcg      1320
     gcggtgcgac gtcctgtcgc gggcggcctc tcggcgtccg agcaggcggg cggcgtgcgc      1380
     cgcgcggtgg cgggaggcag gtccgcgtcg gagcagtcca cgacccgccg cccggtcgcc      1440
     gacgaggcga cgccccacgc cccccagccc gagcagccgg agcaggcggc aggcggcagg      1500
     cgcagggccg acccccgcga cgaggccccc cagcccgccg cgggcaggcg cgcggcgccc      1560
     gagccggacc cggcggcggg cgcgcacgcg gacggcaagt ccgtcagcga actcctggcg      1620
     gccttcggcg gcggcgactc cccccgccgc agacgccgcc gcgaggacta g               1671
//

If you have problems or comments...

PBIL Back to PBIL home page