(data stored in ACNUC7421 zone)

EMBL: CP001630.PE315

CP001630.PE315       Location/Qualifiers
FT   CDS_pept        complement(349936..351012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0320"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 49kDa;
FT                   KEGG: bcz:BCZK4997 NADH dehydrogenase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34289"
FT                   /db_xref="GOA:C6WGH3"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH3"
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /protein_id="ACU34289.1"
FT                   /translation="MQITVGVGAGAKHLGVDRVVDLGPLHPSAHGAYRLRLTVRDDEVI
FT                   TSAEPLVGHLHRGAEKLFEVRDYRQVLTLANRHDWLAAFCNELAVALAVERMTGMDVPP
FT                   RAQWLRALLCELNRVMAHLVFLAPLTDPVAAARGREAVQAVLEEASGGRIHFMANRIGG
FT                   LREDVPAGWAERVAGALDAVEVPEVPTGLAGLGVLSRADALARGVTGPIGRASGVDLDL
FT                   RRDDPLPAYRELDVRPSVRDGGDAHARVACMVDDLAQAVALARECLRRLPGGPVNLRLP
FT                   KAVKAPEGSVYTRVEAPLGVSGVHLASRGEKTPWRLKLRTPSFNNVQALSALLPGTPVA
FT                   QLPLVLGSFAVVVGDIDR"
     gtgcagatca ccgtgggcgt gggagctggg gccaagcacc tcggggtcga ccgggtggtc        60
     gacctggggc cgctgcaccc ctccgcgcac ggggcctacc ggctgcggct gaccgtgcgg       120
     gacgacgagg tgatcacctc ggccgagccg ctggtcgggc acctgcaccg gggcgcggag       180
     aagctgttcg aggtgcgcga ctaccggcag gtgctgaccc tggcgaaccg gcacgactgg       240
     ctggcggcgt tctgcaacga gctggccgtg gcgctggcgg tcgagcggat gaccgggatg       300
     gacgtgccgc cgcgcgcgca gtggctgcgg gcgctgctgt gcgagctgaa ccgggtcatg       360
     gcgcacctgg tgttcctggc cccgctgacc gacccggtgg cggcggcgcg ggggcgggag       420
     gccgtgcagg cggtgctgga ggaggcgtcc ggcgggcgca tccacttcat ggccaaccgg       480
     atcggcgggc tgcgcgagga cgtcccggcg ggctgggcgg agcgggtggc gggcgcgctg       540
     gacgcggtcg aggtccccga ggtgccgacc ggcctggcgg ggttgggggt gctgagccgg       600
     gcggacgcgc tggcgcgggg cgtgaccggc ccgatcgggc gggcgtccgg ggtggacctg       660
     gatttgcggc gcgacgaccc gctgcccgcg taccgggagc tggacgtgcg gccgagcgtg       720
     cgggacggcg gcgacgcgca cgccagggtc gcgtgcatgg tcgacgacct ggcgcaggcg       780
     gtggcgctgg cgcgcgagtg cctgcgacgc ctgccgggcg gcccggtgaa cctgaggctg       840
     cccaaggcgg tcaaggcccc ggaggggtcg gtgtacacgc gggtggaggc gccgctcggg       900
     gtgtcggggg tgcacctggc gtcgcgcggg gagaagacgc cgtggcggct gaagctgcgg       960
     acgccgtcgt tcaacaacgt gcaggcgctg tccgcgctgc tgccgggaac cccggtggcg      1020
     caactccccc tggtgctcgg ctcgttcgcg gtcgtcgtcg gcgacatcga ccgctga         1077
//

If you have problems or comments...

PBIL Back to PBIL home page