(data stored in ACNUC7421 zone)

EMBL: CP001630.PE317

CP001630.PE317       Location/Qualifiers
FT   CDS_pept        351540..352457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0322"
FT                   /product="protein of unknown function DUF185"
FT                   /note="PFAM: protein of unknown function DUF185; KEGG:
FT                   lch:Lcho_0104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34291"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH5"
FT                   /inference="protein motif:PFAM:PF02636"
FT                   /protein_id="ACU34291.1"
FT                   /translation="MQDVESAWRTALYGPSGFFTRGEAPSDHFRTAPLVGPELAEALLE
FT                   LLRRVDTALDRPDALDLVDLGAGGGELSAAVRALADADPALRDRLRVTAVDVGPTRDLP
FT                   GVRWTRDLPDRVTGLLVAHEWLDALPCPVVAWPHRDPWLDRWWPLRPGGRAEIGAPRDA
FT                   AWASAVARVRGAALAIDYGHLADDRAAGRYPRGTFTAYRSGNQVAPVFDGSCDLTAHVA
FT                   LDACAEAAGRPWTLVSQRDALAALGLPAEPLTARTPDWLTAAARASRIAELRDPHGLGA
FT                   FGWLLHPRGTTTADLLPDLPPWRP"
     gtgcaggacg tggaatcggc gtggcgcacc gcgctctacg ggccgtcggg cttcttcacc        60
     aggggagagg cgccgtcgga ccacttccgc accgccccgc tggtcggccc cgagctggcg       120
     gaggcgctcc tggagctgct ccgccgcgtg gacaccgccc tggaccgccc ggacgccctg       180
     gacctcgtgg acctcggcgc gggcggcggc gagctgtccg cggcggtccg cgccctcgcc       240
     gacgccgacc ccgcgctccg cgaccgcctc cgcgtgaccg ccgtggacgt cggcccgacc       300
     cgcgacctcc ccggcgtccg ctggacccgc gacctccccg accgcgtcac cggcctcctg       360
     gtcgcgcacg agtggctgga cgccctcccc tgccccgtgg tggcctggcc gcaccgggac       420
     ccctggctgg accgctggtg gccgctgcgc cccggtgggc gggcggagat cggcgccccg       480
     agggacgcgg cgtgggcgtc ggccgtcgca cgggtccggg gcgcggcgct cgcgatcgac       540
     tacggccacc tggccgacga ccgcgccgcg ggccgctacc ccaggggcac cttcaccgcc       600
     taccgctccg ggaaccaggt cgccccggtc ttcgacggct cctgcgacct gaccgcccac       660
     gtcgccctgg acgcctgcgc cgaggccgcg ggccgcccgt ggaccctggt gtcgcagcgg       720
     gacgccctgg ccgccctcgg cctgcccgcc gagccgctca ccgcccgcac ccccgactgg       780
     ctcaccgccg cggcccgcgc ctcccggatc gcggagctgc gcgaccccca cggcctcggc       840
     gccttcggct ggctcctgca cccgaggggg acgaccaccg ccgacctgct ccccgacctg       900
     ccgccgtggc gcccctga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page