(data stored in ACNUC7421 zone)

EMBL: CP001630.PE318

CP001630.PE318       Location/Qualifiers
FT   CDS_pept        352527..353855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0323"
FT                   /product="putative membrane protein"
FT                   /note="KEGG: scl:sce5075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34292"
FT                   /db_xref="GOA:C6WGH6"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH6"
FT                   /inference="protein motif:COG:COG2339"
FT                   /protein_id="ACU34292.1"
FT                   /translation="MTAAAPSPARKRTEQRRWTVLLPVAALIVLGVCGLVLLGLGTSKV
FT                   GLAPILVGAAASLLPVMAVLSAYLWLDRWEPEPAKILLFGFAWGACGATITSLVFNQTA
FT                   QVIGELINDGDGATFAAVVGAPIVEEATKGVFLIALFLRRRHEFDGAVDGLVYAGVVAA
FT                   GFAFTENIYYFARVFVDSGLGDASSGVVALFILRGVLSPFAHPLFTSMLGIGVGLAAMS
FT                   HKRGVRIAGPLLGYLGAVGLHSLWNFSTTVGTGSTFINLYFLIMVPIFAGMVWLVVWQR
FT                   RREQRIVAEQLPGMAERQWIAASEVTLLASLQGRSRWRRTVRRKAGDGAAKAVAGYQVA
FT                   ATELAFLRHRMALGTAGADADRRHANLLRSLLATRVAAVNAPGALGAADGAGRPRLTER
FT                   AERTVRIARIARQGRAARPDAQGRPGSPTSPNDPDATGGVRRS"
     gtgaccgctg ccgcaccctc gccggcccgc aagaggaccg agcaacgccg ctggaccgtg        60
     ctcctcccgg tcgcggccct gatcgtgctg ggggtctgcg gtctggtcct gctgggcctg       120
     ggcaccagca aggtcgggct ggccccgatc ctggtgggcg cggcggcctc gctcctgccg       180
     gtcatggcgg tgctgagcgc ctacctctgg ctcgaccgct gggagccgga accggccaag       240
     atcctgctct tcggcttcgc ctggggcgcg tgcggcgcga ccatcacctc cctggtcttc       300
     aaccagaccg cccaggtgat cggcgagctg atcaacgacg gcgacggcgc gaccttcgcc       360
     gccgtggtcg gggccccgat cgtggaggag gccaccaagg gcgtcttcct gatcgccctc       420
     ttcctgcgcc gccgccacga gttcgacggc gccgtcgacg gcctcgtcta cgcgggcgtg       480
     gtcgcggcgg gcttcgcgtt caccgagaac atctactact tcgcccgcgt cttcgtggac       540
     agcggcctgg gcgacgcgag cagcggcgtg gtcgccctgt tcatcctgcg cggcgtcctg       600
     tccccgttcg cccacccgct gttcacctcg atgctcggca tcggcgtggg cctggcggcg       660
     atgtcccaca agcggggcgt gcggatcgcg ggcccgctcc tgggctacct gggcgcggtg       720
     ggcctgcact cgctgtggaa cttctccacc acggtcggca ccggctcgac gttcatcaac       780
     ctctacttcc tgatcatggt cccgatcttc gcgggcatgg tctggctggt ggtgtggcag       840
     cgccgccgcg agcagcgcat cgtcgccgag cagctgcccg gcatggccga gcgccagtgg       900
     atcgccgcca gcgaggtcac cctgctcgcc agcctccagg gccgcagccg ctggcgccgc       960
     accgtccgcc gcaaggcggg cgacggggcg gcgaaggcgg tggccggcta ccaggtggcc      1020
     gccacggaac tggcgttcct gcgccaccgc atggcgctgg gcacggcggg cgcggacgcg      1080
     gaccgccgcc acgcgaacct cctgcgctcc ctgctggcca cccgcgtggc cgccgtgaac      1140
     gcccccggcg cgctcggcgc ggcggacggc gcgggccgtc cccggctcac cgagcgcgcg      1200
     gagcgcaccg tccggatcgc gcgcatcgcc cgccagggcc gcgcggcccg cccggacgcc      1260
     cagggccgcc ccggctcccc gacctcgccg aacgaccccg acgccacggg tggcgttcgt      1320
     cgcagttga                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page