(data stored in ACNUC7421 zone)

EMBL: CP001630.PE319

CP001630.PE319       Location/Qualifiers
FT   CDS_pept        353944..354837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0324"
FT                   /product="putative cytoplasmic protein"
FT                   /note="KEGG: sat:SYN_02774 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34293"
FT                   /db_xref="GOA:C6WGH7"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR019665"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH7"
FT                   /inference="similar to AA sequence:KEGG:SYN_02774"
FT                   /protein_id="ACU34293.1"
FT                   /translation="MDATPRPARLAAGVISAGRVGSVLGAALTRAGHAVSAVSAVGAAS
FT                   LRRADALLPDVPVLPPPDVAAGADLVLLAVPDDELPGLVRGLVATGSLRAGQIVVHVSG
FT                   AQGVAALAPAAEVGALCLALHPAMTFTGRPEDVDRVRACTFGVTAADGDDIAWSVGEAL
FT                   VVEIGAEAVRVPESARPLYHAALTHGANHLMTLVADCAEALRGAGVANPERVLAPLLGA
FT                   ALDNALRHGDRALTGPVARGDTGTVAKHLAVLADRAPGTLDAYRALARRTADRAESAGL
FT                   LPADRATDVRTTLDED"
     atggacgcga ccccccgccc cgcgcgcctg gccgcgggcg tcatctcggc aggccgggtg        60
     ggctcggtgc tcggcgccgc cctcaccagg gcgggccacg ccgtctccgc ggtctccgcc       120
     gtcggggccg cctccctgcg cagggccgac gccctgctcc ccgacgtccc cgtgctgccc       180
     ccgcccgacg tggccgcggg cgccgacctg gtcctgctcg ccgtccccga cgacgagctg       240
     cccggcctgg tcaggggcct ggtggccacc ggctcgctgc gcgcgggcca gatcgtggtg       300
     cacgtcagcg gcgcccaggg cgtcgccgcg ctcgcccccg ccgccgaggt gggcgcgctg       360
     tgcctggcgc tgcaccccgc catgaccttc accggccgcc ccgaggacgt ggaccgggtc       420
     cgcgcctgca ccttcggggt caccgccgcc gacggcgacg acatcgcctg gagcgtcggc       480
     gaggcgctcg tcgtggagat cggggccgag gccgtccggg tcccggagtc cgcccgcccg       540
     ctctaccacg ccgccctcac ccacggcgcc aaccacctga tgaccctggt cgccgactgc       600
     gccgaggcac tgcgcggcgc gggcgtcgcc aaccccgagc gggtcctcgc gcccctcctc       660
     ggggccgcgc tcgacaacgc cctgcggcac ggcgaccgcg ccctcaccgg ccccgtcgcc       720
     aggggcgaca ccggcaccgt cgccaagcac ctcgccgtgc tggccgaccg cgcccccgga       780
     accctggacg cgtaccgcgc gctcgccagg cgcaccgcag accgggccga gtccgccggg       840
     ctgctcccgg ccgaccgcgc caccgacgtc cgcaccaccc tcgacgagga ctga             894
//

If you have problems or comments...

PBIL Back to PBIL home page