(data stored in ACNUC7421 zone)

EMBL: CP001630.PE32

CP001630.PE32        Location/Qualifiers
FT   CDS_pept        complement(35861..36493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0032"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: scl:sce5559
FT                   HTH-type transcriptional regulator BetI"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34006"
FT                   /db_xref="GOA:C6WCI5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR041674"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI5"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU34006.1"
FT                   /translation="MTSTTPLRRQPVQQRSAKRVERMLEACAALIEEVGYDGVTTTLIA
FT                   ERAGVAVGSLYQFFPDKRAVVQELTLRNLERFIQTVDGTFTTKALAHWWDAVDSIFDVY
FT                   VAMHREVPAFSRLHFGDVVDLRLMDDRKDNNSVVSDRIAEMISSRFAIPLDEVKLPISI
FT                   AVEAADGVLGLAFRRDPAGDPLVLDEAKAMIRGYLSTRMPGQPPATP"
     gtgactagca cgaccccctt gcgcaggcag ccggtgcagc agcgcagcgc caagcgcgtc        60
     gagcggatgc tggaggcctg cgccgcgctg atcgaggagg tcggctacga cggggtcacc       120
     accacgctca tcgccgagcg ggcgggcgtc gcggtcggct cgctctacca gttcttcccg       180
     gacaagcggg ccgtcgtgca ggagctgacc ctgcgcaacc tggagcggtt catccagacc       240
     gtggacggca ccttcaccac caaggcgctg gcgcactggt gggacgcggt cgactcgatc       300
     ttcgacgtct acgtggcgat gcaccgcgag gtgcccgcgt tcagcaggct gcacttcggc       360
     gacgtggtcg acctgcggct gatggacgac cgcaaggaca acaactccgt ggtgtccgac       420
     cggatcgccg agatgatctc cagccgcttc gcgatacccc tggacgaggt caagctgccg       480
     atctcgatag ccgtcgaggc ggcggacggc gtgctgggcc tggccttccg ccgcgacccg       540
     gcgggcgacc cgctcgtcct cgacgaggcc aaggcgatga tccggggcta cctgtccacc       600
     cggatgccgg ggcagccccc ggccaccccc tag                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page