(data stored in ACNUC7421 zone)

EMBL: CP001630.PE320

CP001630.PE320       Location/Qualifiers
FT   CDS_pept        354841..355731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0325"
FT                   /product="pantoate/beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="KEGG: mno:Mnod_1014 pantoate/beta-alanine ligase;
FT                   TIGRFAM: pantoate/beta-alanine ligase; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34294"
FT                   /db_xref="GOA:C6WGH8"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH8"
FT                   /inference="protein motif:TFAM:TIGR00018"
FT                   /protein_id="ACU34294.1"
FT                   /translation="MTKPLTKDDYTPGGVTVHRDPERLRRVTRALRSAGRNIALVPTMG
FT                   ALHEGHRRLIREAHVLQNTVVVVSVFVNPTQFGEAADLERYPRDLDADVEVCRQERAPL
FT                   VFAPEVATMYPAGSQVTLDPGPLGSELEGASRPGHFAGVLTVVSKLFNVVQPDYALFGE
FT                   KDYQQLSLIGRMATDLNVPTAVVGVPTVRESDGLALSSRNRFLSESERESATALSAALV
FT                   AGSHVSALGAEAVLSTARATLDAVPGLDLDYLELRAPDLGPAPVNGDARLLVAARVGST
FT                   RLIDNVPVLLGAGDE"
     atgacgaagc cgctgaccaa ggacgactac acccccggcg gggtgaccgt gcaccgcgac        60
     cccgagcggc tgcgccgcgt caccagggcg ctgcgctcgg cgggccgcaa catcgcgctc       120
     gtgcccacca tgggcgcgct gcacgagggc caccgcaggc tcatccgcga ggcccacgtc       180
     ctgcagaaca ccgtcgtggt ggtgtcggtg ttcgtgaacc cgacccagtt cggcgaggcc       240
     gccgacctgg agcgctaccc gcgcgacctg gacgccgacg tggaggtgtg ccgccaggag       300
     cgcgcgccgc tggtgttcgc ccccgaggtc gccaccatgt acccggcggg cagccaggtc       360
     accctcgacc ccggaccgct cggctccgag ctggagggcg ccagcaggcc cggccacttc       420
     gcgggcgtgc tcaccgtcgt gtcgaagctg ttcaacgtcg tgcagcccga ctacgccctg       480
     ttcggcgaga aggactacca gcagctctcc ctgatcgggc ggatggccac cgacctgaac       540
     gtgccgaccg ccgtcgtcgg cgtgccgacc gtgcgcgagt cggacgggct cgccctgtcc       600
     tcccgcaacc gcttcctgtc cgagtcggag cgggagagcg ccaccgcgct gtccgccgcg       660
     ctcgtcgccg gctcgcacgt gagcgccctg ggcgcggagg ccgtgctgtc caccgcccgc       720
     gcgacgctcg acgccgtgcc gggcctcgac ctggactacc tggagctgcg cgcccccgac       780
     ctcggccccg cgccggtgaa cggggacgcc cgcctgctgg tggcggcccg cgtcgggtcg       840
     accaggctga tcgacaacgt ccccgtgctg ctcggcgcgg gcgacgagta g                891
//

If you have problems or comments...

PBIL Back to PBIL home page