(data stored in ACNUC7421 zone)

EMBL: CP001630.PE321

CP001630.PE321       Location/Qualifiers
FT   CDS_pept        355746..356216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0326"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="KEGG: bcb:BCB4264_A1597 aspartate 1-decarboxylase;
FT                   TIGRFAM: aspartate 1-decarboxylase; PFAM: aspartate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34295"
FT                   /db_xref="GOA:C6WGH9"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH9"
FT                   /inference="protein motif:TFAM:TIGR00223"
FT                   /protein_id="ACU34295.1"
FT                   /translation="MFRTMLKSKIHRATVTQADLHYVGSVTVDEDLMDAADLLAGEQVA
FT                   IVDVTNGARLETYVIPGERGSGVIGINGAAAHLVHPGDLVILIAYGSMDDAEARAYRPR
FT                   VVFVDADNKVVELGSDAARAPEGSGLLSGAVTAQALAETADAAALDALIQNQ"
     atgttccgca cgatgctcaa gtcgaagatc caccgggcca ccgtcaccca ggccgacctg        60
     cactacgtcg gctcggtcac cgtggacgag gacctcatgg acgccgccga cctgctggcg       120
     ggcgagcagg tcgcgatcgt ggacgtcacc aacggggccc gcctggagac ctacgtcatc       180
     cccggcgagc gcggctccgg cgtcatcggc atcaacggcg ccgccgcgca cctggtgcac       240
     cccggcgacc tggtcatcct catcgcctac gggtccatgg acgacgccga ggcgcgcgcc       300
     taccggccgc gcgtggtgtt cgtcgacgcc gacaacaagg tcgtggagct gggctcggac       360
     gccgcgcgcg cccccgaggg ctccgggctg ctcagcggcg cggtgaccgc gcaggcactc       420
     gccgagacgg ccgacgccgc cgccctcgac gcgctcatcc agaaccagta g                471
//

If you have problems or comments...

PBIL Back to PBIL home page