(data stored in ACNUC7421 zone)

EMBL: CP001630.PE322

CP001630.PE322       Location/Qualifiers
FT   CDS_pept        356227..357012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0327"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: ank:AnaeK_1477 putative
FT                   transcriptional acitvator, Baf family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34296"
FT                   /db_xref="GOA:C6WGI0"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI0"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ACU34296.1"
FT                   /translation="MLLVIDVGNTNIVLGLYDGTGDSAALVHSWRMRTDARMTADELAL
FT                   TMRGLLGEYADKITGISALSTVPAVLRELRVMLGRYYASVPKVLVEPGVRTGVPLLVDN
FT                   PKEVGSDRVINTMAAHHLHSTACVVVDFGTSTNLDVISAKGEFLGGALAPGIEISVDAL
FT                   AARAAQLHKVELVRPRSVIGKNTVECLQSGIVYGFVGQVDGLVRRIVEELATVDPGPVT
FT                   VLATGGLAPLVVSESTAIQIHAPDLTLLGLRLVFERNMR"
     gtgctgctcg tcatcgacgt cggcaacacg aacatcgtcc tcggcctgta cgacggcacg        60
     ggggactccg ccgcgctcgt gcacagctgg cggatgcgca ccgacgccag gatgaccgcc       120
     gacgagctgg cgctgaccat gcgcggcctg ctcggcgagt acgccgacaa gatcaccggc       180
     atctccgcgc tgtccaccgt gcccgcggtg ctgcgcgagc tgcgcgtgat gctcggccgc       240
     tactacgcct cggtgccgaa ggtgctggtc gagccgggcg tgcgcaccgg cgtcccgctc       300
     ctggtggaca acccgaagga ggtcggctcc gaccgggtca tcaacacgat ggccgcgcac       360
     cacctgcaca gcaccgcgtg cgtcgtggtc gacttcggca cgtccaccaa cctggacgtc       420
     atctccgcca agggcgagtt cctcggcggc gcgctggcgc ccggcatcga gatctcggtg       480
     gacgcgctgg ccgcccgcgc cgcgcagctg cacaaggtcg agctggtccg gccgcgctcg       540
     gtgatcggca agaacaccgt cgagtgcctc cagtccggca tcgtctacgg cttcgtcggc       600
     caggtcgacg gcctggtgcg gcggatcgtg gaggagctgg ccaccgtcga ccccggcccg       660
     gtgaccgtgc tggccaccgg tggtctcgcg ccgctggtgg tgtccgagtc gaccgcgatc       720
     cagatccacg cccccgacct gaccctgctg ggcctgcgcc tggtgttcga gcgcaacatg       780
     cgctga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page