(data stored in ACNUC7421 zone)

EMBL: CP001630.PE323

CP001630.PE323       Location/Qualifiers
FT   CDS_pept        complement(357087..357866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0328"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mno:Mnod_8065 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34297"
FT                   /db_xref="GOA:C6WGI1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI1"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACU34297.1"
FT                   /translation="MTSAEDHADLWARRAASFGAQASAYAEHRPDYPAEAIKWCLDPLE
FT                   STPLRVLDLAAGTGKLTAGVVALGHHVTAVEPDEQMLSELVRRNGGVRALPGTAERIPV
FT                   PGGTVDAVVVGQAFHWFDQTRALAEIARVLRPGGVLAALWTGDDHTVPWVADYLSAVWG
FT                   VDGDPHKIGSSGGPAEIMPQHEMFHDQETARFAHRQRRTPETLVATLRTHSGVATLPEA
FT                   ERLALEAKALDFLRSREETRDGFDLPLRVMVKRMVRV"
     gtgacgagcg cagaagacca cgcggacctg tgggctcgcc gggccgcgtc tttcggggct        60
     caagcgtccg cctacgcgga gcaccggccc gactacccgg ccgaggcgat caagtggtgc       120
     ctggaccccc tggagagcac gccgctgcgc gtgctggacc tggcggcggg caccggcaag       180
     ctgaccgcgg gcgtggtggc gctgggccac cacgtgacgg ccgtggagcc cgacgagcag       240
     atgctctcgg agctggtcag gcgcaacggg ggcgtgcggg ccctgccggg gacggccgag       300
     cgcatcccgg tgcccggcgg cacggtcgac gcggtcgtcg tggggcaggc gttccactgg       360
     ttcgaccaga cgcgggcgct ggcggagatc gcccgcgtgc tgcggccggg cggggtgctg       420
     gcggcgctgt ggaccggcga cgaccacacc gtgccgtggg tggccgacta cctgtcggcc       480
     gtgtggggcg tcgacggcga cccgcacaag atcggctcgt cgggcggccc ggccgagatc       540
     atgccgcagc acgagatgtt ccacgaccag gagaccgcgc ggttcgcgca ccggcagcgc       600
     aggaccccgg agacgctcgt ggcgacgctg cggacgcact cgggggtcgc caccctgccg       660
     gaggccgagc ggctggccct ggaggccaag gcgctggact tcctgcgctc cagggaggag       720
     acgcgggacg ggttcgacct gccgctgcgg gtgatggtca agcggatggt gcgggtctga       780
//

If you have problems or comments...

PBIL Back to PBIL home page