(data stored in ACNUC7421 zone)

EMBL: CP001630.PE324

CP001630.PE324       Location/Qualifiers
FT   CDS_pept        357929..359440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0329"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: dal:Dalk_1784 lysyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34298"
FT                   /db_xref="GOA:C6WGI2"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI2"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ACU34298.1"
FT                   /translation="MSEQPQTGSPTSDDDLPEQLRVRREKRARLLERGVDPYPVEVART
FT                   HSLREVREAHTGLDPDTGTGEVVGVTGRVMFIRNTGKLAFATLREGDGTELQAMLSLNK
FT                   VGEQALADWKSDVDLGDHVFVRGEVITSRRGELSVMADEWAITAKALRPLPVAHKELAE
FT                   ETRIRQRYVDLILREQARDTVRNRAKLVRSLRESFHRRGFTEVETPMLQTLQGGAAARP
FT                   FVTRSNALDIDLFLRIAPELYLKRCVVGGIEKVFEINRNFRNEGIDSSHSPEFSMLEYY
FT                   EAYATYDTNAVMTRELIQEAAMAVAGSHVVTLVDGTEYDLGGEWTTLTMYGSLSEAAGV
FT                   EVTPGTSVDDLRALADKLGLETDPKLGHGKLVEELWEHLVGDHLHAPTFVRDFPVETSP
FT                   LTRQHRSTPGVAEKWDLYVRGFELATGYSELVDPVVERERLEAQARLGASGDVEAMPVD
FT                   EDFLRSLEYGMPPSGGVGMGIDRLLMAITGLGIRETILFPLVRPE"
     gtgagtgagc agcctcagac cggttccccg accagcgacg acgaccttcc cgagcagctc        60
     cgggtccgcc gggagaagcg ggcgcggctg ctggagcgcg gcgtcgaccc gtacccagtc       120
     gaagtagccc gcacgcactc gctccgcgag gtgcgcgagg cgcacaccgg gctggacccc       180
     gacaccggca ccggcgaggt ggtcggcgtg accggccgcg tcatgttcat ccggaacacc       240
     ggcaagctgg ccttcgcgac cctgcgcgag ggcgacggca ccgagctcca ggccatgctg       300
     agcctgaaca aggtcggcga gcaggcgctc gccgactgga agagcgacgt cgacctcggc       360
     gaccacgtct tcgtgcgcgg agaggtgatc acctcccggc gcggggaact gtccgtgatg       420
     gcggacgagt gggccatcac ggcgaaggcg ctgcgcccgt tgccggtcgc ccacaaggaa       480
     ctcgcggagg aaacccgcat tcggcagcgg tacgtcgacc tgatcctgcg ggaacaggcg       540
     cgcgacaccg tgcgcaaccg cgccaagctg gtgcgctctc tgcgcgaatc gttccaccgc       600
     aggggtttca cggaagtcga gaccccgatg ttgcagacct tgcagggggg cgcggcggcg       660
     cggccgttcg tcacccgctc gaacgcgctg gacatcgacc tgttcctgcg gatcgcgccg       720
     gagttgtacc tgaagaggtg cgtggtcggc ggtatcgaga aggtcttcga gatcaaccgg       780
     aacttccgca acgagggcat cgactcctcg cactcgccgg agttctcgat gctggagtac       840
     tacgaggcgt acgcgacgta cgacacgaac gcggtgatga ccagggagct gatccaggag       900
     gcggccatgg ccgtcgccgg ttcgcacgtg gtcaccctgg tcgacggcac cgagtacgac       960
     ctgggcggcg agtggaccac gctgaccatg tacggctcgc tgtccgaggc cgcaggcgtc      1020
     gaggtcacgc cagggaccag cgtggacgac ctgcgcgcgc tcgcggacaa gctcggtctg      1080
     gagaccgacc cgaagctcgg ccacggcaag ctcgtcgagg agctgtggga gcacctggtg      1140
     ggcgaccacc tgcacgcgcc cacgttcgtc cgggatttcc cggtcgagac ctcgccgctg      1200
     acccgccagc accgcagcac ccccggtgtg gcggaaaagt gggacctcta cgtgcgcggt      1260
     ttcgagttgg cgaccggata ctccgaactg gtcgacccgg tggtcgagcg ggagcggttg      1320
     gaagcgcagg ccaggttggg cgcgagcggt gacgtggaag cgatgccggt cgacgaagac      1380
     tttctgcgat cgctggagta cggaatgcca ccgagcggtg gtgtgggaat gggcatcgac      1440
     cgcctgctga tggccatcac gggcctcggt atccgggaga cgatcctgtt ccccctcgtg      1500
     cgcccggaat ga                                                          1512
//

If you have problems or comments...

PBIL Back to PBIL home page