(data stored in ACNUC7421 zone)

EMBL: CP001630.PE325

CP001630.PE325       Location/Qualifiers
FT   CDS_pept        359559..359909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34299"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042254"
FT                   /db_xref="InterPro:IPR042261"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34299.1"
FT                   /translation="MAQKVTVTLVDDLDGGVAEETVDFGLDGVAYQIDLSSVNAGKLRS
FT                   ALGAFTTAARKTGGRKRGPGRPAGVKAAARPASADREQNQAIREWARKQGMKVSDRGRI
FT                   PAEVLEAYHQQG"
     atggcgcaga aggtcaccgt gaccctggtc gatgacctgg acggcggtgt cgccgaggag        60
     acggtcgact tcggcctgga cggtgtggct taccagatcg acctttcttc ggtgaatgcg       120
     ggcaagctgc gctccgcgct cggcgcgttc accaccgccg cccgcaagac cggtggtcgc       180
     aagcgcggcc ccggccgccc ggcaggtgtg aaggccgccg cccgacccgc ctcggcggac       240
     cgcgagcaga accaggcgat tcgggagtgg gcccgcaagc agggcatgaa ggtctccgac       300
     cgcggtcgca tcccggccga ggtgctggag gcctaccacc agcaggggtg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page