(data stored in ACNUC7421 zone)

EMBL: CP001630.PE326

CP001630.PE326       Location/Qualifiers
FT   CDS_pept        360226..361230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0331"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   pde:Pden_3523 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34300"
FT                   /db_xref="GOA:C6WGI4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI4"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACU34300.1"
FT                   /translation="MVTVRTTRRYGVLALLLGALALAAAASVAFGSKSIDLGSVAHALL
FT                   SPTGTEDDSIVRELRLPRTGFAIAVGMALGIGGALIQGHTRNPLADPGILGINQGAGFA
FT                   VVLAISLLGVTSPLGYVWFAFAGALAASVVVFLLGSGRNGPTPVTLALAGAAVSALLQG
FT                   LISGVVLSDRQSLDSFRFWQVGSVEGRDVEVLWQVLPFLVVGLVLAAFNAPGLNALSLG
FT                   DEVARSLGQNVNRTRALGIGAITLLVGGSVAACGPIGFLGLVVPHAARAVTGPDHRWLL
FT                   PVAGLMGGVLLLVADVLGRVVARPGELEVGIVMALVGAPFFVALVRRRNLVKL"
     gtggtgaccg tccgcacgac ccgccgctac ggcgtgctcg cgctgctgct gggcgcgctc        60
     gccctggccg ccgccgcgag cgtcgcgttc ggctccaagt cgatcgacct cggctcggtg       120
     gcgcacgccc tgctcagccc gaccggcacc gaggacgact cgatcgtccg cgagctgcgc       180
     ctgcccagga cgggcttcgc gatcgccgtc ggcatggcgc tgggcatcgg cggcgcgctg       240
     atccagggcc acacccgcaa cccgctcgca gaccccggca tcctcggcat caaccagggc       300
     gcgggcttcg ccgtggtcct cgcgatctcc ctgctgggcg tgaccagccc gctcggctac       360
     gtctggttcg ccttcgcggg cgcgctcgcc gccagcgtcg tggtcttcct gctcggctcc       420
     ggccggaacg ggcccacccc ggtcaccctc gccctcgcgg gcgccgcggt cagcgcgctg       480
     ctccagggcc tgatctccgg cgtggtgctg tccgaccggc agagcctgga ctcgttccgg       540
     ttctggcagg tcggctcggt cgaggggcgc gacgtcgagg tcctgtggca ggtgctgccg       600
     ttcctggtcg tcgggctggt gctcgcggcg ttcaacgcgc cagggctcaa cgccctctcg       660
     ctcggcgacg aggtggcccg ctcgctgggc cagaacgtga accgcaccag ggcgctgggc       720
     atcggcgcga tcaccctgct ggtcggcggc tcggtcgcgg cctgcgggcc gatcggcttc       780
     ctcggcctgg tggtcccgca cgccgcccgc gcggtgaccg ggccggacca ccggtggctg       840
     ctgccggtgg ccgggctgat gggcggcgtg ctgctgctcg tggcggacgt cctcggccgg       900
     gtggtcgccc ggcccggcga gttggaggtc ggcatcgtga tggccctggt gggcgccccg       960
     ttcttcgtcg cgctggtccg ccgccggaac ctggtgaagc tgtga                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page