(data stored in ACNUC7421 zone)

EMBL: CP001630.PE327

CP001630.PE327       Location/Qualifiers
FT   CDS_pept        361227..362411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0332"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   ppg:PputGB1_1806 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34301"
FT                   /db_xref="GOA:C6WGI5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI5"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACU34301.1"
FT                   /translation="MSGDGGAAGEGTAAHGATATGATAVGLASGVPVGGDALARPTVKG
FT                   RTGVRLGPLSWPLRWRPIALVLGGLALAATVLAVAIAYGDFPISLGQVVDVLLGGGSRS
FT                   QRFVVMELRLPRVLTGLLVGAALAASGAIFQAISRNPLATPDIIGVTWGAGTGAVLVIV
FT                   LAGSSGAAAGAVAQVGVPLAALAGGLIAGLVVYGIAWRRGIEGFRLVLVGVGVTAITAN
FT                   ATQYLLTKADVNDTARAMVWIAGSLNNRGWEHIVPVALALVVLLPASVLATRTLGALQF
FT                   GDDTTRGLGVRLNGARTALLLLGVVLAAVATAAAGPVGFVALAAPQIAVRLAGTATPPL
FT                   FGSAVVGAVLVVLSDLIARQLIDGTELPVGVVTAVLGAPYLMHLLIRSRREART"
     gtgagcgggg acggcggcgc ggcgggggag gggaccgctg cgcacggcgc gactgccacc        60
     ggcgccaccg cggtcggcct cgcgtccggc gtcccggtcg gtggcgacgc gctcgcgcgc       120
     ccgaccgtga agggccgcac cggcgtccgc ctcggcccgc tctcctggcc gctgcgctgg       180
     cgcccgatcg ccctggtcct cggcggcctc gcgctcgccg cgaccgtcct cgccgtcgcc       240
     atcgcctacg gcgacttccc gatcagcctc ggccaggtcg tcgacgtgct gctcggcggc       300
     ggcagccgca gccagcggtt cgtcgtcatg gagctgcgcc tgccgcgcgt gctcaccggc       360
     ctgctggtcg gcgccgcgct cgccgcctcc ggcgcgatct tccaggccat ctcccgcaac       420
     ccgctggcca ccccggacat catcggcgtc acctggggcg cgggcaccgg cgcggtgctg       480
     gtcatcgtcc tggcgggcag ctccggcgcc gccgcgggcg cggtcgccca ggtcggcgtg       540
     ccgctggccg cgctcgccgg cggcctgatc gccgggctgg tggtctacgg catcgcctgg       600
     cggcgcggca tcgagggctt ccggctcgtc ctggtcggcg tcggcgtcac cgcgatcacc       660
     gcgaacgcca cccagtacct gctcaccaag gccgacgtga acgacaccgc ccgcgccatg       720
     gtctggatcg cgggcagcct caacaaccgg ggctgggagc acatcgtccc ggtcgcgctc       780
     gccctggtcg tgctgctgcc cgcctccgtg ctggccaccc gcacgctcgg cgcgctccag       840
     ttcggcgacg acaccaccag gggcctcggc gtgcggctca acggcgcccg caccgccctg       900
     ctgctgctcg gcgtcgtgct cgccgccgtg gccaccgccg ccgcgggccc cgtcgggttc       960
     gtggcgctgg ccgccccgca gatcgccgtg cgcctggcgg gcacggcgac cccgccgctg      1020
     ttcggctcgg ccgtcgtcgg cgccgtgctg gtcgtgctct ccgacctgat cgcccgccag      1080
     ctgatcgacg gcacggagct gccggtcggc gtggtcaccg ccgtgctcgg cgccccgtac      1140
     ctgatgcacc tgctcatccg cagccgccgg gaggcgagga catga                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page