(data stored in ACNUC7421 zone)

EMBL: CP001630.PE328

CP001630.PE328       Location/Qualifiers
FT   CDS_pept        362408..363256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0333"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cvi:CV_2234 enterobactin-iron transport system
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34302"
FT                   /db_xref="GOA:C6WGI6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34302.1"
FT                   /translation="MTTAPPSPSARLRAHELSIGYGDRVIVDRLDLDVLDGAVTAVIGP
FT                   NGCGKSTMLRALARLLPTRGGQVLLDGRPITEVPTREVAKVLGMLPQTPQGPEGLTVAD
FT                   LVARGRHPHQAWYRQWSGDDEAAVAEALRLTGMEDFAERTLDQLSGGQRQRAWISMALA
FT                   QGTDLLLLDEPTTYLDLAHQIDVLDLVRLLHAEGGRTIVMVLHDLNLAARYADHLVAMK
FT                   DGRIVVQGAPSEVLTEQVLKEVFGLEAAVIEDPVAGTPMVVPIRSTTHAAANRRKDHPK
FT                   G"
     atgaccacgg cacccccgtc ccccagcgcg cgcctgcgcg cccacgagct gtcgatcggc        60
     tacggcgacc gggtgatcgt cgaccggctc gacctggacg tgctcgacgg cgccgtcacc       120
     gccgtcatcg gccccaacgg ctgcggcaag tccacgatgc tgcgcgcgct cgcccgcctg       180
     ctgcccacca ggggcgggca ggtcctgctc gacggcaggc cgatcaccga ggtgcccacc       240
     cgcgaggtgg ccaaggtgct cgggatgctg ccgcagaccc cgcagggccc cgaggggttg       300
     accgtggccg acctggtcgc caggggcagg cacccgcacc aggcctggta ccggcagtgg       360
     tccggcgacg acgaggccgc cgtcgccgag gcgctgcggc tgaccggcat ggaggacttc       420
     gccgagcgca ccctcgacca gctctccggc ggccagcgcc agcgcgcctg gatctccatg       480
     gcgctcgccc agggcaccga cctgctgctg ctcgacgagc ccacgaccta cctggacctc       540
     gcgcaccaga tcgacgtgct ggacctggtg cggctgctgc acgccgaggg cgggcgcacg       600
     atcgtcatgg tgctgcacga cctgaacctc gccgcccgct acgccgacca cctggtggcc       660
     atgaaggacg gtcggatcgt ggtgcagggc gcgccgtccg aggtgctgac cgagcaggtg       720
     ctcaaggagg tcttcgggct ggaggccgcc gtcatcgagg acccggtcgc gggcaccccg       780
     atggtggtgc cgatccggtc cacgacgcac gcggcggcca accgcaggaa agaccacccg       840
     aagggctga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page