(data stored in ACNUC7421 zone)

EMBL: CP001630.PE329

CP001630.PE329       Location/Qualifiers
FT   CDS_pept        complement(363284..364099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0334"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34303"
FT                   /db_xref="GOA:C6WGI7"
FT                   /db_xref="InterPro:IPR024726"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34303.1"
FT                   /translation="MTVPARIDPRDALNPLADTVSATSSLVGWLEIRYERTGGGAPDGW
FT                   TRCSDLLADPGRFTAWRGELADWLEGQHGGSTERATAGYVLGWYLGAVGMLGGALFHRA
FT                   RRVPSLRPEDLALRLADDGRPDVVGVALLAGGFACLPSDPAGNHPEATVVADESALAAL
FT                   LRARFAGHAAAFAAAYGPTTRLGRRALWAAATDALDGSAWLAGLHGGDEAAGVADSALL
FT                   LPFPEAPYTSATTLRVVDGTWTRRRESCCFHFTLPGAQACDTCPRVCGK"
     atgaccgtac cggcgcggat cgacccccgc gacgcgctga accccctggc ggacaccgtt        60
     tcggccacgt cctccctggt ggggtggctg gagatccgct acgagcgaac gggcggcggc       120
     gcacccgatg gatggacccg gtgctccgac ctgctcgccg atccggggcg gttcaccgcc       180
     tggcgcggcg agctcgcgga ctggctggag gggcagcacg gcggctccac cgagcgcgcc       240
     acggccgggt acgtgctcgg ctggtacctg ggcgcggtcg ggatgctcgg cggcgcgctg       300
     ttccaccggg cgcgccgggt cccgtcgctg cgccccgagg acctggcgct gcggctggcc       360
     gacgacggca ggcccgacgt ggtcggcgtg gcgctgctgg cgggcggctt cgcctgcctg       420
     cccagcgacc cggcgggcaa ccaccccgag gcgaccgtcg tggccgacga gtccgcgctg       480
     gccgcgctgc tgcgcgcccg gttcgccggg cacgccgccg cgttcgccgc cgcctacggc       540
     ccgaccaccc ggctgggaag gcgggcgctg tgggcggcgg ccacggacgc gctggacggc       600
     tcggcgtggc tggccgggct gcacggcggc gacgaggcgg ccggggtcgc ggactccgcg       660
     ctgctgctgc cgttccccga ggccccgtac acctcggcga cgacgttgcg cgtggtcgac       720
     gggacctgga cgcgccgccg ggagagctgc tgcttccact tcacccttcc gggggcgcag       780
     gcgtgtgaca cctgcccccg cgtctgcggg aagtga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page