(data stored in ACNUC7421 zone)

EMBL: CP001630.PE33

CP001630.PE33        Location/Qualifiers
FT   CDS_pept        36613..37875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0033"
FT                   /product="beta-galactosidase"
FT                   /note="TIGRFAM: beta-galactosidase; PFAM: glycoside
FT                   hydrolase family 1; KEGG: hch:HCH_06907
FT                   beta-glucosidase/6-phospho-beta-
FT                   glucosidase/beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34007"
FT                   /db_xref="GOA:C6WCI6"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI6"
FT                   /inference="protein motif:TFAM:TIGR03356"
FT                   /protein_id="ACU34007.1"
FT                   /translation="MTGPDFLWGVSTSAFQIEGGFDEDGRLPSVWDEFPSFEGQTARVA
FT                   CDHRNRHAEDVALLRELGVNAYRFSLSWPRVEGGRAAGSGSAASSGLDFYDRLVDDLLD
FT                   AGIAPVATLYHWDTPAHVEEAGGWLARDTAHRLADYAATAAARLADRVAMWIPVNEPAI
FT                   VTLLGYATGQHAPGKALLFDALPAAHHLNLGHGLAVQALRAAGATSVGTANNHTPAWAA
FT                   TGSAEDAAAASAYADLHNWLYADPVLAGRYPESLVDLLPVEDGDLATIAQPLDFYGVNY
FT                   YNPTRLSAPSPGNPLPFDLVPITEHPVTGFGWPVVPAGLGEMIGALRTRHPNLPPVHVT
FT                   ESGCSYPHSLDDTERVDYLAAHSEAAIAAGAKGYFVWSVLDNFEWDSGYSQRFGLVHVD
FT                   YATQRRTPRASFRWYRDRIRR"
     atgaccggac ctgatttcct ctggggcgtc tcgacttccg ccttccagat cgaggggggc        60
     ttcgacgagg acggcaggct tccctcagtg tgggatgaat ttccctcgtt cgagggacag       120
     accgcgcggg tggcctgcga ccaccgcaac cggcacgccg aggacgtggc gctgctgcgc       180
     gagctggggg tgaacgcgta ccggttctcg ctgtcctggc cccgcgtcga gggcggacgg       240
     gcggccggga gcgggagcgc ggcgagcagc gggctcgact tctacgaccg gctcgtcgac       300
     gacctgctcg acgcgggcat cgcccccgtc gcgacgctct accactggga cacgcccgcc       360
     cacgtggagg aggcgggcgg ctggctcgcg cgggacaccg cgcaccggtt agccgactac       420
     gccgccaccg ccgccgcccg gctggccgac cgggtcgcga tgtggatccc ggtcaacgag       480
     cccgccatcg tcaccctgct cggctacgcc accgggcagc acgcgccggg caaggcgctc       540
     ctgttcgacg cgctgcccgc cgcccaccac ctcaacctcg gccacggcct cgccgtccag       600
     gccctgcgcg cggcgggggc cacctcggtc ggcaccgcca acaaccacac cccggcctgg       660
     gcggccaccg gctccgccga ggacgccgcc gccgcgagcg cgtacgccga cctgcacaac       720
     tggctctacg ccgacccggt cctcgccggg cgctaccccg agtcgctggt cgacctgctg       780
     ccggtcgagg acggcgacct cgccaccatc gcccagccgc tcgacttcta cggcgtcaac       840
     tactacaacc cgacccggct ctcggccccg tcgccgggca acccgctgcc gttcgacctg       900
     gtcccgatca ccgagcaccc ggtcaccggc ttcggctggc ccgtcgtgcc cgccgggctc       960
     ggcgagatga tcggcgccct gcgcaccagg cacccgaacc tgccgcccgt gcacgtcacc      1020
     gagagcgggt gcagctaccc gcactcgctc gacgacaccg agcgcgtcga ctacctggcc      1080
     gcccacagcg aggccgcgat cgccgcgggg gcgaagggct acttcgtctg gtcggtgctg      1140
     gacaacttcg agtgggactc cgggtactcg cagcgcttcg gcctggtcca cgtcgactac      1200
     gccacccagc gccgcacccc gcgcgcctcc ttccgctggt accgcgaccg gatccgccgg      1260
     tga                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page