(data stored in ACNUC7421 zone)

EMBL: CP001630.PE330

CP001630.PE330       Location/Qualifiers
FT   CDS_pept        364370..366928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0335"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: ATPase AAA-2 domain protein; AAA ATPase
FT                   central domain protein; UvrB/UvrC protein; ATPase
FT                   associated with various cellular activities AAA_5; Clp
FT                   domain protein; SMART: AAA ATPase; KEGG: bha:BH0103 class
FT                   III stress response-related ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34304"
FT                   /db_xref="GOA:C6WGI8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI8"
FT                   /inference="protein motif:PFAM:PF07724"
FT                   /protein_id="ACU34304.1"
FT                   /translation="MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVA
FT                   AKALESLGIALEGVRQQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIG
FT                   TEHILLGLIREGEGVAAQVLVKLGADLNRVRQQVLQLLSGYSGGKEPAEAGGRGEGTPS
FT                   SSLVLDQFGRNLTSMAREGKLDPVIGRAKEIERVMQVLSRRTKNNPVLIGEPGVGKTAV
FT                   VEGLAQMVVKGEVPETLKDKQLYTLDLSSLVAGSRYRGDFEERLKKVLKEIRTRGDIIL
FT                   FIDEIHTLVGAGAAEGAIDAASILKPMLARGELQTIGATTLDEYRKYVEKDPALERRFQ
FT                   PIQVGEPSLEHTIEILKGLRDRYEAHHRVSITDSALVAAATLADRYINDRYLPDKAIDL
FT                   IDEAGARMRIRRMTAPPDLREFDEKIADVRRDKESAIDAQDFERAAKLRDQEKTLLGQK
FT                   AEREKQWKDGDLDVVAEVDEEQIAEVLANWTGIPVFKLTEEETTRLLRMEDELHKRIIG
FT                   QVEAVKAVSQAIRRTRAGLKDPKRPAGSFIFAGPSGVGKTELSKALANFLFGEDDALIQ
FT                   IDMGEFHDRYTASRLFGAPPGYVGYEEGGQLTEKVRRKPFSVVLFDEIEKAHNEVYNTL
FT                   LQVLEDGRLTDGQGRTVDFKNTVIIFTSNLGTSDISKAVGLGFASGQDNASNYERMKNK
FT                   VNDELKKHFRPEFLNRIDDIIVFHQLTRDEIIRMVDLLIARVETQLKNKDMAIELTEKA
FT                   KQLLAKRGFDPVLGARPLRRTIQREIEDQLSEKILFGELQPGQIVITDVEGWDGESDQH
FT                   DKAKFVFRSEQKPTKVPDSPPVDLAGAGGDDSAQSEASGE"
     atgttcgaga ggttcaccga ccgcgcgagg cgggtggttg tcctggccca ggaagaggcc        60
     aggatgctca accacaacta catcggcacc gagcacatcc tcctgggttt gatccacgag       120
     ggtgagggtg tcgccgccaa ggcgctggag tcgttgggga tcgcgctgga gggcgtgcgc       180
     cagcaggtcg aggagatcat cggccagggc cagcaggcac ccagcgggca catccccttc       240
     accccgcgcg ccaagaaggt cctggagctg tcgctgcgcg aggcgctgca gctcgggcac       300
     aactacatcg gcacggagca catcctgctc ggcctgatcc gcgagggcga gggcgtcgcc       360
     gcccaggtcc tcgtgaagct gggcgcggac ctcaaccggg tccgccagca ggtgctccag       420
     ctgctctccg gctactccgg cggcaaggag cccgccgagg ccggtggccg gggcgagggc       480
     acgccgtcct cgtcgctggt gctggaccag ttcggccgca acctgacctc catggcccgc       540
     gagggcaagc tcgacccggt catcgggcgg gccaaggaga tcgagcgggt catgcaggtg       600
     ctgtcccggc gcaccaagaa caaccccgtg ctcatcggcg agcccggcgt cggcaagacc       660
     gccgtcgtcg agggcctggc gcagatggtc gtcaagggcg aggtgcccga gacgctgaag       720
     gacaagcagc tctacaccct cgacctcagc tcgctggtgg ccggttcccg ctaccgcggt       780
     gacttcgagg agcgcctgaa gaaggtgctc aaggagatcc gcacccgcgg cgacatcatc       840
     ctgttcatcg acgagatcca caccctggtc ggcgcgggcg ccgccgaggg cgcgatcgac       900
     gccgcgagca tcctcaagcc gatgctggcg cgcggtgagc tccagaccat cggcgccacc       960
     acgctcgacg agtaccgcaa gtacgtcgag aaggacccgg cgctcgagcg ccgcttccag      1020
     ccgatccagg tgggcgagcc ctccctggag cacacgatcg agatcctcaa gggcctgcgc      1080
     gaccggtacg aggcgcacca ccgcgtctcg atcaccgact cggcgctggt ggccgcggcg      1140
     acgctggccg accggtacat caacgaccgg tacctgccgg acaaggcgat cgacctcatc      1200
     gacgaggcgg gcgcgcggat gcgcatccgc cggatgaccg cgccgccgga cctgcgcgag      1260
     ttcgacgaga agatcgcgga cgtgcgccgc gacaaggagt ccgcgatcga cgcgcaggac      1320
     ttcgagcgcg ccgcgaagct ccgcgaccag gagaagaccc tgctgggcca gaaggccgag      1380
     cgggagaagc agtggaagga cggcgacctc gacgtcgtcg ccgaggtcga cgaggagcag      1440
     atcgccgagg tcctggcgaa ctggacgggc atcccggtct tcaagctgac cgaggaggag      1500
     accacccgcc tgctgcgcat ggaggacgag ctccacaagc gcatcatcgg ccaggtcgag      1560
     gccgtcaagg ccgtctcgca ggccatccgg cgcacccgcg ccggcctgaa ggaccccaag      1620
     cgccccgcgg gctcgttcat cttcgccggc ccgtccggcg tcggcaagac cgagctgtcc      1680
     aaggcgctgg cgaacttcct gttcggcgag gacgacgcgc tcatccagat cgacatgggc      1740
     gagttccacg accgctacac cgcctcgcgg ctcttcggcg cgcctcccgg ctacgtcggc      1800
     tacgaggagg gcggccagct caccgagaag gtgcggcgca agccgttctc ggtcgtgctg      1860
     ttcgacgaga tcgagaaggc ccacaacgag gtctacaaca ccctcctgca ggtgctggag      1920
     gacggtcgcc tcacggacgg ccagggccgg acggtggact tcaagaacac cgtcatcatc      1980
     ttcacgtcga acctcggcac ctcggacatc tcgaaggccg tcggactggg cttcgcgtcg      2040
     gggcaggaca acgcctcgaa ctacgagcgc atgaagaaca aggtcaacga cgagctgaag      2100
     aagcacttcc gcccggagtt cctcaaccgc atcgacgaca tcatcgtgtt ccaccagctg      2160
     actcgcgacg agatcatccg gatggtggac ctgctgatcg cgcgcgtcga gacgcagctg      2220
     aagaacaagg acatggcgat cgagctgacc gagaaggcca agcagttgct ggccaagcgg      2280
     ggcttcgacc ccgtgctcgg cgcccgtccg ctgcgcagga ccatccagcg cgagatcgag      2340
     gaccagctgt cggagaagat cctgttcggg gagctccagc ccggccagat cgtcatcacc      2400
     gacgtcgagg gctgggacgg cgagtccgac cagcacgaca aggcgaagtt cgtgttccgc      2460
     agcgagcaga agccgaccaa ggtccccgac tccccgccgg tggacctggc cggtgcgggc      2520
     ggcgacgact ccgcccagag cgaggcctcg ggcgagtga                             2559
//

If you have problems or comments...

PBIL Back to PBIL home page