(data stored in ACNUC7421 zone)

EMBL: CP001630.PE331

CP001630.PE331       Location/Qualifiers
FT   CDS_pept        complement(367074..367718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0336"
FT                   /product="pyrrolidone-carboxylate peptidase"
FT                   /EC_number="3.4.19.3"
FT                   /note="KEGG: saz:Sama_0018 pyroglutamyl-peptidase I;
FT                   TIGRFAM: pyrrolidone-carboxylate peptidase; PFAM: peptidase
FT                   C15 pyroglutamyl peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34305"
FT                   /db_xref="GOA:C6WGI9"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI9"
FT                   /inference="protein motif:TFAM:TIGR00504"
FT                   /protein_id="ACU34305.1"
FT                   /translation="MDDPTVLITGFEPFGGERTNPSWDAVRELAERDPSLIAVELPCAF
FT                   DASARALREAVERHRPDLVVCVGQAGGRSGVTPERVAINLADARIPDNDGAQPIDVPVV
FT                   EGGPAAYFTGLPVKACVAALEEAGIPASVSHTAGTFVCNHVFYALMHLVATDFPDLRGG
FT                   FVHVPFAPEQVADREGVPSLEVSRTADALGLIVATCLSTTDDLAISTGTLS"
     atggacgacc cgacagtgct gatcaccggt ttcgagccgt tcggaggcga gcgcaccaac        60
     ccgtcgtggg acgccgtgcg cgagctggcc gagcgcgatc cctcgctcat cgcggtggag       120
     ctgccgtgcg ccttcgacgc ctcggcccgc gcgctgcggg aggcggtgga gcggcaccgg       180
     ccggacctgg tggtgtgcgt cgggcaggcg ggcgggcgga gcggggtcac gccggagcgg       240
     gtggcgatca acctcgcgga cgctcgcatc ccggacaacg acggggcgca gccgatcgac       300
     gtgccggtgg tcgagggcgg cccggcggcg tacttcaccg ggctgccggt gaaggcgtgc       360
     gtggcggcgc tggaggaggc gggcatcccg gcctcggtgt cgcacacggc gggcacgttc       420
     gtgtgcaacc acgtgttcta cgcgctgatg cacctggtgg cgacggactt cccggacctg       480
     cggggcgggt tcgtgcacgt gccgttcgca ccggagcagg tggcggaccg ggagggcgtg       540
     cccagcctgg aggtgtcgcg gacggcggac gcgctggggc tgatcgtggc gacctgcctg       600
     agcaccacgg acgacctggc gatcagcacc ggcaccctca gctag                       645
//

If you have problems or comments...

PBIL Back to PBIL home page