(data stored in ACNUC7421 zone)

EMBL: CP001630.PE332

CP001630.PE332       Location/Qualifiers
FT   CDS_pept        367737..368708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0337"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   afw:Anae109_1227 endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34306"
FT                   /db_xref="GOA:C6WGJ0"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ0"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ACU34306.1"
FT                   /translation="MIEAPARRVGGRTATALVVLLAVGFLVPALTRLLGVDGNRYLAAT
FT                   TALTPLVTAAGVLVGALALLLRRWPVALVVLPVCLLLAASVTPRAIADDRPAGAGLPLR
FT                   VMASNFLVGKADAEAVVREVVERDVDVLAMQELSPAMVRDLENAGLDAVLPHRAFEDEP
FT                   GGSGSGIASRYPLTPARLVGPSSFRQASAVVELPNGKDVEVVSVHPMPPVEPQGPAQWR
FT                   RDLAALPPRNADGPIRVLAGDFNATLDHAPLRRLLDTGYADAADRVGAGLTPTWPNEGV
FT                   VPPLVALDHVLVDDRCPVDWFTAVDVPGSDHRAVVAQFVVPD"
     gtgatcgaag ctccggcgcg ccgcgtgggg ggccgcaccg cgacggccct ggtcgtcctg        60
     ctcgcggtcg ggttcctcgt cccggcgctc acccgcctgc tcggcgtcga cggcaaccgc       120
     tacctggcgg cgaccaccgc gctgaccccg ctggtgaccg ccgcgggcgt cctggtcggc       180
     gcgctggcgc tgctgctgcg ccgctggccg gtcgcgctgg tcgtcctgcc ggtctgcctg       240
     ctcctggccg cctccgtcac ccccagggcg atcgcggacg accgcccggc gggcgcgggc       300
     ctcccactgc gcgtgatggc ctcgaacttc ctcgtgggca aggccgacgc ggaggcggtg       360
     gtgcgcgagg tggtcgagcg ggacgtcgac gtgctggcca tgcaggagct gtccccggcg       420
     atggtgcggg acctggagaa cgccgggctg gacgccgtgc tgccgcaccg ggcgttcgag       480
     gacgagccgg gcggctcggg ctccggcatc gcctcccgct acccgctcac cccggcgcgc       540
     ctggtgggcc ccagctcctt ccggcaggcg agcgccgtgg tggagctgcc caacggcaag       600
     gacgtcgagg tcgtgtcggt gcacccgatg ccgccggtcg agccgcaggg ccccgcgcag       660
     tggcggcggg acctcgccgc gctgccgccc aggaacgccg acggcccgat ccgggtcctc       720
     gcgggcgact tcaacgccac cctcgaccac gcgcccctgc gcaggctcct ggacaccggt       780
     tacgcggacg ccgccgaccg ggtgggcgcg ggcctgaccc cgacctggcc gaacgagggc       840
     gtcgtgccgc cgctggtggc gctggaccac gtgctggtgg acgaccgctg cccggtcgac       900
     tggttcacgg ccgtggacgt ccccggcagc gaccaccgcg cggtggtcgc ccagttcgtc       960
     gtgccggact ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page