(data stored in ACNUC7421 zone)

EMBL: CP001630.PE333

CP001630.PE333       Location/Qualifiers
FT   CDS_pept        complement(368769..369539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0338"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: afw:Anae109_4302 silent information regulator protein
FT                   Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34307"
FT                   /db_xref="GOA:C6WGJ1"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ1"
FT                   /inference="protein motif:PFAM:PF02146"
FT                   /protein_id="ACU34307.1"
FT                   /translation="MVSGAGALLVCAGAGMGVDSGLPDFRGHAGFWRAYPPYERLGLGF
FT                   EEIADPVHFARDPEFAWGFYGHRLALYRATVPHAGFAVLRRLGARAFTSNVDGQFQLAG
FT                   FAGVAEVHGSIHHLQCQEPCSDDVWSADGVVVEVDPETMRAVSPLPTCPRCGGVARPNI
FT                   LMFGDSSWVGHRTGAQLAELAQWRREVGAGLVVLELGAGTAVPTVRRYAELSSAATGAL
FT                   VRVNPREADVRHGRGIAVPETALEFLDRLAGAAG"
     ctggtctcgg gggcgggcgc gctgctggtg tgcgcgggcg ccgggatggg ggtggactcc        60
     ggtctgcccg acttccgggg gcacgcgggc ttctggcgcg cctacccgcc ctacgagcgg       120
     ctcgggctgg gcttcgagga gatcgcggac ccggtgcact tcgcgcgcga cccggagttc       180
     gcctgggggt tctacgggca ccggttggcg ctgtaccggg cgaccgtgcc gcacgccggg       240
     ttcgcggtgc tgcggcggtt gggggcgcgg gcgttcacgt ccaacgtgga cggccagttc       300
     cagctcgccg ggttcgcggg cgtggccgag gtgcacgggt cgatccacca cctgcagtgc       360
     caggagccct gctccgacga cgtgtggtcg gcggacgggg tcgtggtgga ggtggacccg       420
     gagacgatgc gcgcggtgtc gccgctgccg acgtgccccc ggtgcggtgg ggtggcgcgg       480
     ccgaacatcc tgatgttcgg ggactcctcg tgggtggggc accggaccgg ggcgcagctg       540
     gccgagctgg cccagtggcg gcgggaggtc ggggccgggc tggtggtgct ggagctgggg       600
     gccgggacgg cggtgcccac ggtgcggcgg tacgcggagc tgtcgagcgc ggcgaccggg       660
     gcgctggtgc gggtgaaccc gcgcgaggcg gacgtgcggc acgggcgcgg gatcgcggtg       720
     ccggagacgg cgctggagtt cctggaccgg ttggcgggcg cggcgggctg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page