(data stored in ACNUC7421 zone)

EMBL: CP001630.PE334

CP001630.PE334       Location/Qualifiers
FT   CDS_pept        complement(369553..369864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0339"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   afr:AFE_2662 antibiotic biosynthesis monooxygenase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34308"
FT                   /db_xref="GOA:C6WGJ2"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ2"
FT                   /inference="protein motif:PFAM:PF03992"
FT                   /protein_id="ACU34308.1"
FT                   /translation="MAVVKINAIHVPEGSGPELEKRFEARLRAVDEEPGFLGFQLLRPV
FT                   AGDSRYFVVTHWADDESFDNWRKGRAEAAHAGERAKPVASGADLLEFEVVLESWPERG"
     atggcggttg tgaagatcaa tgcgatccac gtgcccgagg ggtccggccc cgagctggag        60
     aagcggttcg aggcgcggct gcgcgcggtg gacgaggagc ccggtttcct gggcttccag       120
     ctgctgcgcc cggtcgcggg cgactcgcgc tacttcgtgg tgacccactg ggccgacgac       180
     gagtcgttcg acaactggcg caagggccgc gccgaggccg cgcacgcggg cgagcgggcc       240
     aagccggtgg cctcgggcgc ggacctgctg gagttcgagg tcgtgctgga gtcctggcct       300
     gagcgcggct ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page