(data stored in ACNUC7421 zone)

EMBL: CP001630.PE335

CP001630.PE335       Location/Qualifiers
FT   CDS_pept        complement(369874..371352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0340"
FT                   /product="Peptidase M1 membrane alanine aminopeptidase"
FT                   /note="PFAM: Peptidase M1 membrane alanine aminopeptidase;
FT                   KEGG: mxa:MXAN_0644 peptidase, M1 (aminopeptidase N)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34309"
FT                   /db_xref="GOA:C6WGJ3"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ3"
FT                   /inference="protein motif:PFAM:PF01433"
FT                   /protein_id="ACU34309.1"
FT                   /translation="MAISPRARPYLLITAVALLVAGLLVVRLPDGSDTARETPEAPAPA
FT                   STPAVVGQRGGAGAGDPYYPEDGNTGYDVAGYDVSIGYDPATGHLDGVARVTARATADL
FT                   VSFNLDLRGLEVSSVEVGGEGAGFAREGEQELVITPAAPLASGSEFTAVVAYSGEPQSL
FT                   QDPVLGTNGWQRSQSGGAFAAGEPHSATTWYPANDTPRDKASFALSARVPDGWAAVSIG
FT                   LERGSTSEGGWTTFRWEHPEPVATYLTTVAVDRWEFERGALPDGTPVVNAYAPGAEAAR
FT                   AHGQELPSVLAFLADRFGPYPFDAAGGIYLSDRIGFSLETQTRPIYAAWADLETVVHEN
FT                   AHQWFGDAVTIRSWADICLNECFASYSTWLWAESLGADLDADYRAEVEKWRGSTGYWSR
FT                   KLYDMGRGNEFRGVYDKGQLAVHALRARIGDEAFDRALKTWISEHLDANASWPEFEAHV
FT                   QRVSGQDLSAFFQAWFRGDAIPADEHLWPGGLRG"
     atggccatca gccccagggc ccgcccttac ctcctgatca ccgccgtcgc cctgctcgtc        60
     gcgggcctgc tggtcgtgcg actgcccgac gggtcggaca ccgcgcggga gacgcccgag       120
     gcgcccgcgc ccgcgtcgac gcccgccgtg gtggggcagc ggggcggggc gggcgcgggc       180
     gacccgtact acccggagga cgggaacacc ggctacgacg tggccgggta cgacgtgtcc       240
     atcggctacg acccggcgac cggccacctg gacggggtgg cgcgggtgac cgcgcgggcg       300
     accgccgacc tggtgtcgtt caacctggac ctgcgcgggc tggaggtctc ctcggtcgag       360
     gtcgggggcg agggcgcggg gttcgcccgc gagggcgagc aggagctggt gatcacgccc       420
     gccgcgccgc tggcctcggg gtccgagttc accgccgtcg tcgcctactc gggtgagccg       480
     cagtcgttgc aggaccccgt gctgggcacg aacgggtggc agcggtccca gtccggcggg       540
     gcgttcgcgg cgggcgagcc gcactcggcg accacctggt acccggccaa cgacaccccg       600
     cgcgacaagg cgtcgttcgc gctgagcgcg cgggtgccgg acggctgggc ggcggtgtcg       660
     atcgggctgg agaggggctc gaccagcgag ggcggctgga ccacgttccg gtgggagcac       720
     ccggagccgg tggcgaccta cctgaccacc gtggcggtcg accggtggga gttcgagcgg       780
     ggcgcgctgc cggacgggac gccggtggtg aacgcgtacg cgccgggcgc ggaggcggcg       840
     cgggcgcacg ggcaggagct gccgtcggtg ctggcgttcc tggcggacag gttcgggccc       900
     tacccgttcg acgcggcggg cggcatctac ctgtcggacc ggatcgggtt ctcgctggag       960
     acgcagaccc ggccgatcta cgcggcgtgg gcggacctgg agacggtggt gcacgagaac      1020
     gcgcaccagt ggttcggcga cgcggtcacc atcaggagct gggcggacat ctgcctgaac      1080
     gagtgcttcg ccagctactc gacctggctg tgggccgagt cgctgggcgc ggacctggac      1140
     gcggactacc gggccgaggt cgagaagtgg cgcggcagca ccgggtactg gtcgcggaag      1200
     ctgtacgaca tggggcgcgg caacgagttc cggggcgtct acgacaaggg ccagctggcg      1260
     gtgcacgcgc tgcgcgcgcg gatcggcgac gaggcgttcg accgggcgct gaagacctgg      1320
     atctccgagc acctggacgc gaacgcgtcg tggccggagt tcgaggcgca cgtgcagcgg      1380
     gtgtccggtc aggacctgtc ggcgttcttc caggcctggt tccggggtga cgcgatcccc      1440
     gccgacgagc acctgtggcc gggcggcctg cgcggatag                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page