(data stored in ACNUC7421 zone)

EMBL: CP001630.PE336

CP001630.PE336       Location/Qualifiers
FT   CDS_pept        371370..372116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0341"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   ppg:PputGB1_4047 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34310"
FT                   /db_xref="GOA:C6WGJ4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ4"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU34310.1"
FT                   /translation="MSVIEFGGQGQGILLVHGLMSRATTWWKVARWLTAHGRVVAYDAR
FT                   GHGRNPQRGPFRTEDFVADAEALVERLGLGPCVVLGHSMGALHGLALAAARPDLVRAVV
FT                   AEDFVPDNRGRSVDDWRWYFDAWPVPFQSLAHVRSVVDVQGVEEMFEERGDGYHLIAQL
FT                   EDLYEIAAEWGERAYWDVVDAVACPVLVVEAGLHPLGPGQQAEVARRTGGAHLLVPESG
FT                   HVVHDEAPDVYRGAVEAFLSGLNPPV"
     atgagcgtca tcgagttcgg gggacagggg cagggcatcc tgctggtgca cggcctgatg        60
     agcagggcga ccacctggtg gaaggtggcc cgctggctga ccgcgcacgg ccgcgtcgtg       120
     gcctacgacg cgcgcggcca cgggcggaac ccgcagcgcg ggccgttccg cacggaggac       180
     ttcgtcgccg acgcggaggc gctcgtggaa cgcctgggac tgggcccgtg cgtggtgtta       240
     ggtcactcga tgggggcact gcacgggctc gcgctcgccg ccgcgcgacc cgacctggtg       300
     cgcgccgtcg tcgccgagga cttcgtgccg gacaaccggg gcaggtccgt ggacgactgg       360
     cgctggtact tcgacgcctg gccggtgccg ttccagtcgc tggcccacgt gcggtccgtc       420
     gtggacgtgc agggcgtgga ggagatgttc gaggagcgcg gcgacggcta ccacctcatc       480
     gcccagctgg aggacctcta cgagatcgcc gccgagtggg gcgagcgggc ctactgggac       540
     gtggtggacg cggtcgcctg cccggtgctg gtcgtcgagg ccgggctgca cccgctcgga       600
     cccggccagc aggccgaggt ggcgcgccgc acgggcggcg cgcacctgct cgttcccgag       660
     tcggggcacg tcgtccacga cgaggccccc gacgtctacc ggggcgccgt ggaagccttc       720
     ttgagcgggc tcaacccgcc cgtctga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page