(data stored in ACNUC7421 zone)

EMBL: CP001630.PE337

CP001630.PE337       Location/Qualifiers
FT   CDS_pept        complement(372065..372571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34311"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34311.1"
FT                   /translation="MHALVVLFDEEADSAVRALWRGLGATSEFPPHVTWASATAIGPKV
FT                   RAELAADLEHLWLPDLWLRTLGTSAESEPSLDLTAVVDAELLAVHSAIHDVLAGRVRNP
FT                   TARHLPGSWTPRCTLLKGEPAEVSAAFAKVNPVPPIRARVRELSVLDTQTGGLSPLKKA
FT                   STAPR"
     atgcacgcgc tggtggtgct gttcgacgag gaggccgact cggcggtccg ggcgctgtgg        60
     cgcgggctcg gcgcgacctc cgagttcccg ccgcacgtca cctgggcctc ggcgaccgcg       120
     atcggcccca aggtgcgggc cgagctggcc gccgacctgg agcacctgtg gctgccggac       180
     ctgtggctgc gcaccctggg cacctccgcc gagtccgagc cgtccctgga cctgaccgcc       240
     gtcgtggacg ccgagctgct ggccgtgcac tcggcgatcc acgacgtgct ggcgggccgg       300
     gtgcgcaacc cgaccgcccg gcacctgccc ggctcgtgga cgccgcgctg caccctgctc       360
     aagggcgaac cggccgaggt ctcggcggcg ttcgcgaagg tcaacccggt gccgccgatc       420
     cgggcgcggg tgcgcgagct gtccgtcctg gacactcaga cgggcgggtt gagcccgctc       480
     aagaaggctt ccacggcgcc ccggtag                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page