(data stored in ACNUC7421 zone)

EMBL: CP001630.PE338

CP001630.PE338       Location/Qualifiers
FT   CDS_pept        complement(372629..373618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0343"
FT                   /product="HhH-GPD family protein"
FT                   /note="PFAM: HhH-GPD family protein; helix-hairpin-helix
FT                   motif; SMART: HhH-GPD family protein; KEGG: scl:sce3935
FT                   A/G-specific adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34312"
FT                   /db_xref="GOA:C6WGJ6"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ6"
FT                   /inference="protein motif:PFAM:PF00730"
FT                   /protein_id="ACU34312.1"
FT                   /translation="MSRTTSPTTSRATNRTASATTATAAAGAAEDAAKPESAHLPPSVL
FT                   NTWFAATARDLPWRDPECTAWGVLVSEIMLQQTPVARVEPIWRVWLDKWPRPSDMAAAS
FT                   QGEVLRMWGKLGYPRRALRLHAAAQAVAAEHDDVVPDDVETLLALPGIGAYTARAVAAF
FT                   AYGRRCPVVDTNVRRVVARAVHGAGDAGPPSTTRDLRDVEALLPEDEASAATYSAALME
FT                   LGALVCTARTPRCSACPVLGSCQWQRNGRPAYDGPAKAVQKFAGTDRQVRGRLLDVLRG
FT                   TSEPVAKEVLDRAWSDAGQRDRCLHSLLVDGLVEQTAAGLFALPGEHE"
     atgagccgca cgacgagtcc caccacgagc cgcgcgacga accggaccgc gagcgccacc        60
     accgccaccg ccgcagcggg cgctgccgag gacgccgcca agccggagag cgcccacctt       120
     cccccgtcgg tgctgaacac ctggttcgcc gccaccgcgc gcgacctgcc ctggcgcgac       180
     cccgagtgca ccgcctgggg cgtcctggtc agcgagatca tgctccagca gacccccgtc       240
     gcccgcgtcg agccgatctg gcgggtctgg ctggacaagt ggccgaggcc cagcgacatg       300
     gccgccgcct cccagggcga ggtgctgcgc atgtggggca agctcggcta cccgcgccgc       360
     gccctgcgcc tgcacgccgc cgcccaggcc gtcgccgccg agcacgacga cgtcgtcccg       420
     gacgacgtgg agaccctgct ggccctgccc ggcatcggcg cgtacaccgc gcgggccgtc       480
     gccgccttcg cctacggccg ccgctgcccg gtggtggaca ccaacgtccg ccgcgtcgtg       540
     gcgcgggccg tgcacggggc cggggacgcg ggcccgccgt cgaccaccag ggacctgcgg       600
     gacgtggagg cgctgctgcc cgaggacgag gcgtcggccg cgacctactc ggcggcgctg       660
     atggagctgg gcgcgctggt gtgcacggcc aggaccccgc gctgctcggc gtgcccggtg       720
     ctgggctcgt gccagtggca gcgcaacggg cggcccgcgt acgacgggcc cgcgaaggcg       780
     gtgcagaagt tcgcgggcac cgaccggcag gtgcgcgggc ggctgctgga cgtgctgcgc       840
     ggcacgtccg agccggtcgc caaggaggtg ctggaccggg cctggtcgga cgccggtcag       900
     cgggaccggt gcctgcactc gctgctggtg gacgggctgg tcgagcagac cgccgccggg       960
     ctgttcgcgc tgcccggcga gcacgagtga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page