(data stored in ACNUC7421 zone)

EMBL: CP001630.PE339

CP001630.PE339       Location/Qualifiers
FT   CDS_pept        complement(373677..374168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0344"
FT                   /product="carbonic anhydrase"
FT                   /note="PFAM: carbonic anhydrase; KEGG: aba:Acid345_1601
FT                   carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34313"
FT                   /db_xref="GOA:C6WGJ7"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ7"
FT                   /inference="protein motif:PFAM:PF00484"
FT                   /protein_id="ACU34313.1"
FT                   /translation="MTAIDELLRRNEELGNIVPGDRSSPMPSMQVTILTCMDSRIRVFE
FT                   IFGLKQGEAHVLRNAGGVVTDDMIRSLALSQRKLGTREVLLVHHTNCGLELVTEDAFKD
FT                   ELETDSGMRPPWSVEAFREVKDSVRGSVNRVRNSPYLIHRDTVRGFVYDVRTGVLTEVV
FT                   "
     atgaccgcga tcgacgagct gctccgccgg aacgaggagc tggggaacat cgtccccggc        60
     gaccgctcct cccccatgcc ctcgatgcag gtgacgatcc tgacctgcat ggactcccgg       120
     atcagggtct tcgagatctt cggcctcaag cagggcgagg cgcacgtgct gcgcaacgcg       180
     ggcggggtcg tcaccgacga catgatccgc tcgctggcgc tcagccagcg caagctcggc       240
     accagggagg tgctgctggt gcaccacacc aactgcggcc tcgaactggt caccgaggac       300
     gccttcaagg acgagctgga gaccgactcc gggatgcgcc cgccgtggtc ggtggaggcg       360
     ttccgcgagg tgaaggacag cgtgcgcggc tcggtgaacc gggtgcgcaa cagcccgtac       420
     ctgatccacc gggacaccgt gcgcgggttc gtctacgacg tgcgcaccgg ggtgctcacc       480
     gaggtggtct ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page