(data stored in ACNUC7421 zone)

EMBL: CP001630.PE34

CP001630.PE34        Location/Qualifiers
FT   CDS_pept        37872..39179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0034"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ccs:CCNA_02400 transporter, major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34008"
FT                   /db_xref="GOA:C6WCI7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU34008.1"
FT                   /translation="MSALGPGAPDPAITGPAAPNPVVPDSAATAHDPLAEPVAPVGRGW
FT                   TTLLFLANLGLWLGVYAPIQVLLPQQAERISPDAKELVFGLVTALGAAVALIANPLIGL
FT                   SSDRTCSRFGRRHPWTLAGALVGALGLAVLSAADATWSMALGWCLVQAGLNGMLASLTS
FT                   GVPDRVPVAQRARVGGLVGISQMLGTVLGAVVVTVLVTGQTAGYLVCAALVVAGALAFV
FT                   LATPDTRLPRAARPPLVARELWVSPKRHPDFAWAWTAHFAINLGNALGTLYLLFFLADE
FT                   VRHPSPEDGLLVLMLLYGAALVVGAVLVGARSDRTGRRRGGVHLSAALMALAALLLAAW
FT                   PTWWSALIAAPLLGFGFGAYWAVALALLTQVLPAATDRAKDLGVVNVANALPQVLAPAL
FT                   ASVVLVDLGGYRGLFLLSAAATLVASLCVTRIRGVR"
     gtgagcgccc tcggaccggg cgcgccggac cccgcgataa ccggccccgc cgcgccgaac        60
     ccagtcgtgc cggattccgc cgcgaccgcc cacgacccgc tcgccgaacc ggtcgccccg       120
     gtcggccggg gctggacgac cctgctgttc ctggccaacc tcggcctgtg gctcggcgtc       180
     tacgccccga tccaggtgct gctcccgcag caggccgagc ggatctcgcc cgacgcgaag       240
     gagctggtgt tcggactggt cacggccctg ggcgcggctg tggcgctgat cgccaacccg       300
     ctcatcgggc tgtcctcgga ccgcacctgc tcccggttcg gccgccgcca cccgtggacc       360
     ctcgcgggcg cgctggtcgg cgcgctcggc ctggccgtgc tctccgccgc cgacgcgacc       420
     tggtcgatgg cgctcggctg gtgcctggtc caggccgggc tcaacgggat gctcgccagc       480
     ctcacctccg gcgtccccga ccgggtgccg gtggcgcagc gggccagggt cggcggactc       540
     gtcggcatca gccagatgct cggcaccgtg ctgggcgccg tcgtggtgac cgtgctggtc       600
     accggccaga ccgccggcta cctggtgtgc gcggcgctgg tcgtcgcggg cgcgctggcg       660
     ttcgtgctcg ccaccccgga cacccggctg ccgcgcgccg cccgcccgcc gctcgtcgcg       720
     cgcgagctgt gggtctcccc gaagcggcac cccgacttcg cctgggcgtg gaccgcgcac       780
     ttcgccatca acctcggcaa cgcgctcggc accctctacc tgctgttctt cctggccgac       840
     gaggtgcgcc acccgtcgcc cgaggacggc ctgctggtgc tgatgctgct ctacggcgcg       900
     gcgctcgtgg tcggcgcggt gctcgtcggc gcccgctccg accgcaccgg ccgcaggcgc       960
     ggcggcgtcc acctgtccgc cgcgctcatg gcgctggccg cgctgctgct cgccgcctgg      1020
     cccacctggt ggtccgcgct gatcgcggcc ccgctgctcg ggttcggctt cggcgcctac      1080
     tgggcggtcg cgctggccct gctcacccag gtgctgcccg ccgcgaccga ccgcgccaag      1140
     gacctcggcg tcgtcaacgt cgcgaacgcg ctgccccagg tgctcgcccc cgcgctggcg      1200
     tcggtggtgc tggtcgacct cggcggctac cggggcctgt tcctgctctc ggcggcggcg      1260
     acgctcgtcg cctcgctgtg cgtcacgcgg atcagaggag tgcgatga                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page