(data stored in ACNUC7421 zone)

EMBL: CP001630.PE341

CP001630.PE341       Location/Qualifiers
FT   CDS_pept        complement(375152..376255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0346"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI;
FT                   KEGG: gox:GOX0577 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34315"
FT                   /db_xref="GOA:C6WGJ9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ9"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACU34315.1"
FT                   /translation="MARSMHVRRPATLASLAAELGVSRTTVSNAYNRPDQLSPELRRRV
FT                   LETARRLGYPGPDPVARSLRTRKAGAVGLLLTENLSYAFRDPAAIGFLEGLALACETAG
FT                   QGLLLVPANPEREDVAAVHRAGVDGFVVYSVPDDDPHLAAVLERPVPTVVCDQPDLADV
FT                   DRVGIDDRAAMHQLAQHLIALGHRRVGVVCMRLARDRNDGFVPLSRQESAHFHVQRSRM
FT                   SGLRQAFTEVGVDWASVPVVERFDHTIAQGASAAAQVLDRDPQITALICTSDILALGAL
FT                   QEAERRGLRVPADLTVTGFDGIREAEQAGLTTVRQPVLEKGRAAGKLLMEIGERTKPRT
FT                   VTLETELITGTTAAEPRTIAEERWFGH"
     atggcgcggt cgatgcatgt gcgacgcccg gcgacgttgg cctctctggc cgcggagctg        60
     ggggtttccc ggacaacggt gtccaacgcg tacaaccgtc ccgaccagct ctcgccggag       120
     ctgcgacgcc gggtgttgga gacagcgagg cgacttggat atcccggccc cgatccggtg       180
     gccagatcgc tgcgcacgcg caaagcgggc gcggtcggtc tgctgctgac cgagaacctc       240
     tcctacgcgt tccgggaccc ggcggcgatc ggattcctgg aagggctcgc gctggcctgc       300
     gagacggccg ggcaggggct gctgctcgtg cccgccaacc ccgagcgcga ggacgtggcg       360
     gccgtgcacc gggcgggcgt cgacggcttc gtcgtctact ccgtgcccga cgacgacccg       420
     cacctcgccg cggtgctgga gcggccggtg ccgaccgtcg tgtgcgacca gcccgacctg       480
     gccgacgtcg accgcgtggg catcgacgac cgggccgcga tgcaccagct cgcgcagcac       540
     ctgatcgcgc tggggcaccg gcgggtcggc gtggtgtgca tgaggctcgc gcgggaccgc       600
     aacgacgggt tcgtgccgct gtcgcggcag gagtcggcgc acttccacgt gcagcggtcc       660
     cggatgagcg ggctgcgcca ggcgttcacc gaggtcgggg tcgactgggc ctcggttccg       720
     gtggtggagc ggttcgacca cacgatcgcg caaggcgcct cggcggcggc ccaggtcctg       780
     gaccgggacc cgcagatcac ggcgctgatc tgcacctcgg acatactggc cctcggcgcg       840
     ctgcaggagg cggagcggcg gggcctgcgg gtgcccgcgg acctcacggt gaccgggttc       900
     gacggcatcc gggaggccga gcaggccggg ctgaccacgg tgcggcagcc ggtgctggag       960
     aagggccgcg cggcgggcaa gctgctgatg gagatcggcg agcgcaccaa gcccaggacc      1020
     gtgacgctgg agaccgagct gatcaccggc acgacggcgg ccgagcccag gacgatcgcc      1080
     gaggagcggt ggttcgggca ctga                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page