(data stored in ACNUC7421 zone)

EMBL: CP001630.PE342

CP001630.PE342       Location/Qualifiers
FT   CDS_pept        complement(376377..377420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0347"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: pen:PSEEN1955 ribose operon repressor RbsR;
FT                   PFAM: periplasmic binding protein/LacI transcriptional
FT                   regulator; regulatory protein LacI; SMART: regulatory
FT                   protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34316"
FT                   /db_xref="GOA:C6WGK0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK0"
FT                   /inference="protein motif:PRIAM:5.1.1.1"
FT                   /protein_id="ACU34316.1"
FT                   /translation="MPGLAEIARAAGVSISTVSRVLNRRAGVNDETRQRVLAVLAEMPY
FT                   TPRGLGALQRTGVIGLLVPELSNPVFPAFAEALEVRAARLGYSSLLCNTRASGDAAMGE
FT                   EEYVRMLLARGVEGMVFVSPEITNAEAPLGRAARPSYYSRLLADGVHMVFVNGATPALD
FT                   VPDVTVDEQHAGYAATRHLVELGHRLIGFVSGPARALPSRLKRAGWAAALEEAGLGADG
FT                   SLVAHGPFGPEGGALAVAELLDSVRPTAVICSSDHMAIGVLREAHKRGLSVPGDLSVVG
FT                   FDDIPLAPYCSPPLTTLAQPIEEMATAAVDELVLRLDPDRRRRHSANYTRVFRPRLVVR
FT                   ESTASPE"
     gtgcccggac tggccgagat cgccagggcc gccggggtga gcatctcaac cgtgagccgc        60
     gtgctgaacc gccgagcggg ggtcaacgac gagacccgcc agcgggtgct cgccgtgctg       120
     gcggagatgc cgtacacccc gcgcgggctc ggcgcgctgc agcggaccgg cgtgatcggg       180
     ctgctggtgc cggagctgtc gaacccggtg ttcccggcgt tcgccgaggc gctggaggtc       240
     agggcggccc gactcggcta ctcgtcgctg ctgtgcaaca cgcgggcgtc cggggacgcg       300
     gcgatgggcg aggaggagta cgtccggatg ctgctggcca ggggcgtcga gggcatggtg       360
     ttcgtctcgc cggagatcac caacgccgag gcgccgctgg ggcgggccgc gcggccgagc       420
     tactactccc ggctgctggc cgacggggtg cacatggtgt tcgtgaacgg ggcgacgccc       480
     gcgctggacg tgccggacgt gaccgtggac gagcagcacg cggggtacgc ggcgaccagg       540
     cacctggtgg agctggggca ccggctgatc gggttcgtca gcgggcccgc gcgggcgctg       600
     ccgtcgcggc tcaagcgggc cgggtgggcg gcggcgctgg aggaggccgg gctcggcgcg       660
     gacggctcgc tcgtcgcgca cggcccgttc gggccggagg gcggggcgct cgcggtggcg       720
     gagctgctcg actccgtacg gccgacggcg gtgatctgct cgtccgatca catggcgata       780
     ggggtgctcc gagaggcgca caagcggggt ttgtccgttc ccggcgatct ctcggtggtc       840
     ggtttcgacg acatcccgct ggccccctac tgctctcccc cgctcaccac tctggcgcaa       900
     ccgatcgagg aaatggcgac cgccgcggtg gacgaactcg tgctgcgttt ggaccccgat       960
     cggcgcagaa ggcacagcgc gaactacacg agagtgttcc gccctcgcct tgttgttcga      1020
     gaatcaacag catcgcccga ataa                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page