(data stored in ACNUC7421 zone)

EMBL: CP001630.PE343

CP001630.PE343       Location/Qualifiers
FT   CDS_pept        377686..378945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0348"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: oan:Oant_3895 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34317"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK1"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACU34317.1"
FT                   /translation="MRRTTLLTALAAGLAPALALTACGGSSGGGGASGEVVFWDTSGPN
FT                   ESPVFTKVAQDCAAKDGYQVKTETVAFDAALNNYKTAAQGGQGPDVFRAEVAWVPQLAK
FT                   NGLVLDLTGTDLVKDTSDFLETPLGSTVYEGKTYGVPQVTDSLALFYNKKLLADAGVQP
FT                   PKTWDELKSVAAKLGGEKAFFVNNDAYYALPFLYGAGGDLVDAEAKEIVVSSPENVKGL
FT                   ETAKGLVDAKAATTALDAGNSYSNMQAGFGSGEIAMVVNGPWSVPDYLKGAAFADESNL
FT                   GIAPVPGVTEATAGLAPVGGHDYVVRQGAKAKDNALKLIACMSSAESQAKIATELGLLP
FT                   TRKSAYEVAEVKANAVVAAFEPVVAQAHPRPWIPEGGQLFDPLKTAYADFLAGKKDAKS
FT                   ALDEVAKTYKDQILPEYTVG"
     atgcgacgta ccaccctcct gacggcactg gccgcgggct tagcccccgc cctcgccctc        60
     accgcctgcg gtggctcttc cggcggcggc ggcgcgagcg gcgaggtcgt cttctgggac       120
     accagcggtc ccaacgagag ccccgtcttc accaaggtcg cccaggactg cgcggccaag       180
     gacggctacc aggtcaagac cgagaccgtc gccttcgacg cggcgctcaa caactacaag       240
     accgccgcgc agggcgggca gggcccggac gtgttccgcg ccgaggtcgc ctgggtgccg       300
     cagctggcca agaacggcct cgtcctcgac ctgaccggca ccgacctggt caaggacacc       360
     tcggacttcc tggagacccc gctcgggtcc acggtctacg agggcaagac ctacggcgtc       420
     ccccaggtca ccgactcgct cgccctcttc tacaacaaga agctgctggc cgacgcgggc       480
     gtgcagcccc cgaagacctg ggacgagctg aagtccgtcg ctgccaagct cggcggcgag       540
     aaggcgttct tcgtcaacaa cgacgcctac tacgccctgc ccttcctcta cggcgcgggc       600
     ggcgacctgg tcgacgccga ggccaaggag atcgtggtct cctcgccgga gaacgtgaag       660
     ggcctggaga ccgccaaggg cctggtcgac gccaaggccg ccaccaccgc gctcgacgcg       720
     ggcaactcct acagcaacat gcaggccggc ttcggctccg gcgagatcgc catggtcgtc       780
     aacggcccct ggtccgtccc cgactacctc aagggcgccg cgttcgccga cgagtccaac       840
     ctcggcatcg cgcccgtccc cggcgtcacc gaggccaccg ccgggctcgc cccggtcggc       900
     ggccacgact acgtggtgcg ccagggcgcc aaggccaagg acaacgcgct caagctcatc       960
     gcctgcatga gctccgccga gtcccaggcg aagatcgcca ccgagctggg cctgctgccc      1020
     acccgcaagt ccgcctacga ggtcgccgag gtcaaggcca acgcggtcgt cgcggccttc      1080
     gagccggtcg tcgcccaggc ccacccccgg ccgtggatcc ccgagggcgg ccagctgttc      1140
     gacccgctca agaccgccta cgccgacttc ctcgcgggga agaaggacgc caagtccgcg      1200
     ctggacgagg tcgccaagac ctacaaggac cagatcctgc ccgagtacac cgtcggctga      1260
//

If you have problems or comments...

PBIL Back to PBIL home page